KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2455Help
Entry
Tgr7_2455         CDS       T00840                                 

Definition
Dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tgr7_2455
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tgr7_2455
   00020 Citrate cycle (TCA cycle)
    Tgr7_2455
   00620 Pyruvate metabolism
    Tgr7_2455
Enzymes [BR:tgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Tgr7_2455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2603385..2604692)
Genome map
AA seq 435 aa AA seqDB search
MSNVVEVKVPDIGDFKDVEIIDVLVKPGDAVKAEDPLITLESDKATIDIPSPGAGVIKAL
KVKKGDRVSQGDAIADMEAAAGAPAEKPAQKAAEKPAEPAPSPKAAEPERADTGSAAEPA
RPAGPRPSPTAGLVNEEGFRKAHASPTVRRFARELGVDLGAVDGSGPKGRILREDVQGYV
KRALAQGGGGLGVAPMPEIDFSQFGPVETQALTKINKLTGQNLHRNWVTIPHVTQFDEAD
ITELESFRKTLAEEYKDKGVKITFLAFLMKAVVSALKEYPRVNASLDATGEHLILKQYYH
VGVAVDTPDGLVVPVIRDVDRMSLVDIARALQEMSQKARDKKLKPADMQGGCFTISSLGG
IGGTSFTPIVNAPEVAILGVSRAKMQPVWNGKEFTPRMILPLSLSYDHRVIDGALGARFT
TFLSSRLSDMRRMLL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgtggttgaggtgaaggtcccggacatcggggatttcaaggacgtggaaatc
atcgatgtgctggtcaagccgggtgacgcggtcaaggccgaggacccgctcattaccctg
gaatccgacaaggccaccatcgacatcccgtccccgggcgccggtgtcatcaaggcgctg
aaggtgaaaaagggcgaccgggtctcccagggcgatgccatcgccgacatggaggccgcg
gccggcgcgcccgccgaaaagccggcgcagaaggccgcggagaaacccgccgaaccggcg
ccctcgcccaaggccgccgagccggagcgcgccgacaccgggtccgccgccgagcccgcg
cggcccgccggtccgcgcccctcgcccacggcggggttggtcaacgaggagggcttccgc
aaggcccatgcctcgcccacggtgcgccgtttcgcccgggaactgggcgtggatctgggc
gccgtggacggcagcggccccaaggggcgcatcctcagggaagacgtgcagggctacgtg
aagcgggcgctcgcccagggcggcggcggtctgggcgtggcgcccatgccggagatcgac
ttcagccagttcggtcctgtggagacccaggcgctgaccaagatcaacaagctcaccggt
cagaacctgcaccgcaactgggtgaccatcccccacgtcacccagttcgacgaggcggac
atcaccgagctggagtccttccgcaagaccctggccgaggaatacaaggacaagggggtg
aagatcaccttcctggccttcctgatgaaggcggtggtctcggcgctcaaggaatacccg
cgggtgaacgcctccctggatgccaccggcgagcacctgatcctcaaacagtactatcac
gtcggtgtggcggtggacacgcctgacggcctggtggtgccggtgatccgcgacgtggac
cgcatgagcctggtggatatcgcccgggccctgcaggagatgtcccagaaggcccgggac
aagaagctcaagcccgccgatatgcaggggggctgcttcaccatctccagcctcggcggc
atcggcggcacctcgttcacgcccatcgtcaacgcccccgaggtggccatcctgggcgtc
tcccgggccaagatgcagccggtgtggaacggcaaggaattcaccccgcgcatgatcctg
cccctgtccctgtcctatgatcacagggtcatcgacggcgcgctgggcgcacgcttcacg
acctttttgagcagccggctgtcggatatgcgcaggatgcttctgtag

DBGET integrated database retrieval system