KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2486Help
Entry
Tgr7_2486         CDS       T00840                                 

Definition
protein-disulfide isomerase-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Brite
Enzymes [BR:tgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Tgr7_2486
Secretion system [BR:tgr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Tgr7_2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2638504..2639040
Genome map
AA seq 178 aa AA seqDB search
MVKKPAFWLLALCAALLGATAGASGLPPANPALAEQVEALPEADLIIYSPAEVKHRVTVF
TDVNCPFCRRLHTQMDDYLLFDIEIRYAAFPNINNALEQMHGVWCSEDRKSAMSKAKRNE
IVKVEGCQSRAVDDQLDIALSNRFLGTPAIVTPRGRVLYGHVTAERLIEILELEAASQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaaaaacccgctttctggctcctcgccctgtgcgcggccctgctcggcgccacc
gcaggcgccagcggactgccccccgccaacccagccctggccgagcaggtggaggcactg
cccgaagcggacctgatcatctacagcccggccgaggtcaagcaccgggtcacggtgttc
accgatgtgaactgccccttctgccggcgcctgcacacccagatggacgactacctgctg
ttcgacatcgagattcgctacgcggcatttcccaacatcaacaacgccctggagcagatg
cacggcgtctggtgcagcgaggaccgcaagtcagccatgagcaaggccaagcgcaacgag
atcgtcaaggtggagggatgccagagccgggccgtggatgaccagctggacatcgccctg
agcaaccggttcctgggcacgcccgccatcgtcacccccaggggccgggtgctgtacggc
cacgtcaccgccgagcgcctgatcgagatcctggagctggaggcggccagccagtag

DBGET integrated database retrieval system