KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2550Help
Entry
Tgr7_2550         CDS       T00840                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tgr7_2550
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tgr7_2550
   00630 Glyoxylate and dicarboxylate metabolism
    Tgr7_2550
Enzymes [BR:tgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Tgr7_2550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2689379..2690959
Genome map
AA seq 526 aa AA seqDB search
MHEAVSFTAPIEGFEDLFTPEAVDFLVALHERFAPRVDALLAARKARQARFDAGELPDFL
AETREIRAADWTVGTIPEDLRDRRVEITGPTDRKMLINALNSGAKCFMACLEDAHAPTWR
NGLEGQVNLHDAVTRSIDFTSPEGKHYTLNDQTAVLIVRPRGWHLPEKHMRVNGRAIPGA
LFDFGLYFFHNARTLLDQGTGPYFYLPKLQAHTEARLWNEVFLFAQERLGIPAGTIKVTV
LIETLPAVFELDEILWELKDHIVGLNCGRWDYIFSYIKTFRNHPDRLLPDRAQVSMTVPF
MRAYSQLVIKTCHRRGAFAMGGMAAQIPVRGDEAANETAFAKVRADKEREAKDGHDGTWV
AHPGLVPVAMEVFNTHMPEANQLSRQRPDVNPGRDELIAVPEGTITEAGLRNNINVAIQY
MAAWLGGRGAVPIHNLMEDAATAEISRCQIWQWIRHPGGVLDDGRRVSLEMVERLIPEEM
ETIRQEVGDEAFASGHYQLAAKLFADITKAEELADFLTLIAYEHLE
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaggccgtgagcttcaccgcccccatcgagggcttcgaggacctgttcaccccc
gaggccgtggacttcctggtggccctgcacgagcgcttcgccccccgggtggatgccctg
ctggccgcccgaaaggcgcgccaggcccgcttcgatgccggcgaactgccggacttcctg
gccgagacccgggagatccgcgccgccgactggaccgtcggcaccatccccgaggacctg
cgcgaccggcgcgtggaaatcaccggtcccacggaccgcaagatgctcatcaatgcgctg
aacagcggcgcgaaatgcttcatggcctgcctggaggacgcccacgcccccacctggcgc
aacggcctggagggccaggtgaacctgcacgacgcggtcacgcgcagcatcgacttcacc
tccccggagggcaagcactacacgctcaatgaccagaccgcggtactgatcgtgcgcccc
cggggctggcacctgccggagaagcacatgcgggtgaacggtcgcgccattcccggcgcc
ctgttcgacttcggcctgtacttcttccacaacgcccgcaccctgctggaccagggcacc
ggcccctacttctacctgcccaagctccaggcccacaccgaggcgcggctgtggaacgag
gtgttcctgtttgcccaggagcgcctcggcatccccgccgggaccatcaaggtcacggtg
ctcatcgagaccctcccggcggtgttcgagctggacgagatcctctgggaactgaaggac
cacatcgtcggcctgaactgcggccgctgggattacatcttcagctacatcaagaccttc
cggaatcaccccgaccggctgctgccggaccgcgcccaggtgagcatgaccgtgcccttc
atgcgcgcctattcccagctggtgatcaagacctgccaccgccgcggcgccttcgccatg
ggcggcatggctgcgcagatcccggtgcgcggcgacgaggccgccaacgagacggcgttt
gccaaggtgcgggccgacaaggagcgggaggcgaaggacggccatgacggcacctgggtg
gcgcaccccggactggtgcccgtggccatggaggtgttcaacacgcacatgcccgaggcc
aaccagctgtcgcgccagcgtcccgacgtgaaccccggccgcgacgaactgatcgccgtg
cccgagggcacgatcaccgaggcggggctgcgcaacaacatcaacgtggccatccagtac
atggccgcctggctgggcgggcggggtgcggtgcccatccacaacctcatggaagacgcc
gccaccgccgagatctcccgctgccagatctggcagtggatccgccatccgggcggcgtg
ctggacgacggtcggcgcgtgagcctggagatggtcgagcggctcatccccgaggagatg
gagacgatccgccaggaggtgggtgatgaggccttcgcgtcaggccactatcaactcgcc
gcgaagctgttcgcggacatcacgaaggcggaggaactggcggatttcctgacgctgatt
gcgtacgaacatttggagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system