KEGG   Thioalkalivibrio sulfidophilus: Tgr7_2550Help
Entry
Tgr7_2550         CDS       T00840                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tgr  Thioalkalivibrio sulfidophilus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:tgr01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tgr00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tgr00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2689379..2690959
Genome map
AA seq 526 aa AA seqDB search
MHEAVSFTAPIEGFEDLFTPEAVDFLVALHERFAPRVDALLAARKARQARFDAGELPDFL
AETREIRAADWTVGTIPEDLRDRRVEITGPTDRKMLINALNSGAKCFMACLEDAHAPTWR
NGLEGQVNLHDAVTRSIDFTSPEGKHYTLNDQTAVLIVRPRGWHLPEKHMRVNGRAIPGA
LFDFGLYFFHNARTLLDQGTGPYFYLPKLQAHTEARLWNEVFLFAQERLGIPAGTIKVTV
LIETLPAVFELDEILWELKDHIVGLNCGRWDYIFSYIKTFRNHPDRLLPDRAQVSMTVPF
MRAYSQLVIKTCHRRGAFAMGGMAAQIPVRGDEAANETAFAKVRADKEREAKDGHDGTWV
AHPGLVPVAMEVFNTHMPEANQLSRQRPDVNPGRDELIAVPEGTITEAGLRNNINVAIQY
MAAWLGGRGAVPIHNLMEDAATAEISRCQIWQWIRHPGGVLDDGRRVSLEMVERLIPEEM
ETIRQEVGDEAFASGHYQLAAKLFADITKAEELADFLTLIAYEHLE
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaggccgtgagcttcaccgcccccatcgagggcttcgaggacctgttcaccccc
gaggccgtggacttcctggtggccctgcacgagcgcttcgccccccgggtggatgccctg
ctggccgcccgaaaggcgcgccaggcccgcttcgatgccggcgaactgccggacttcctg
gccgagacccgggagatccgcgccgccgactggaccgtcggcaccatccccgaggacctg
cgcgaccggcgcgtggaaatcaccggtcccacggaccgcaagatgctcatcaatgcgctg
aacagcggcgcgaaatgcttcatggcctgcctggaggacgcccacgcccccacctggcgc
aacggcctggagggccaggtgaacctgcacgacgcggtcacgcgcagcatcgacttcacc
tccccggagggcaagcactacacgctcaatgaccagaccgcggtactgatcgtgcgcccc
cggggctggcacctgccggagaagcacatgcgggtgaacggtcgcgccattcccggcgcc
ctgttcgacttcggcctgtacttcttccacaacgcccgcaccctgctggaccagggcacc
ggcccctacttctacctgcccaagctccaggcccacaccgaggcgcggctgtggaacgag
gtgttcctgtttgcccaggagcgcctcggcatccccgccgggaccatcaaggtcacggtg
ctcatcgagaccctcccggcggtgttcgagctggacgagatcctctgggaactgaaggac
cacatcgtcggcctgaactgcggccgctgggattacatcttcagctacatcaagaccttc
cggaatcaccccgaccggctgctgccggaccgcgcccaggtgagcatgaccgtgcccttc
atgcgcgcctattcccagctggtgatcaagacctgccaccgccgcggcgccttcgccatg
ggcggcatggctgcgcagatcccggtgcgcggcgacgaggccgccaacgagacggcgttt
gccaaggtgcgggccgacaaggagcgggaggcgaaggacggccatgacggcacctgggtg
gcgcaccccggactggtgcccgtggccatggaggtgttcaacacgcacatgcccgaggcc
aaccagctgtcgcgccagcgtcccgacgtgaaccccggccgcgacgaactgatcgccgtg
cccgagggcacgatcaccgaggcggggctgcgcaacaacatcaacgtggccatccagtac
atggccgcctggctgggcgggcggggtgcggtgcccatccacaacctcatggaagacgcc
gccaccgccgagatctcccgctgccagatctggcagtggatccgccatccgggcggcgtg
ctggacgacggtcggcgcgtgagcctggagatggtcgagcggctcatccccgaggagatg
gagacgatccgccaggaggtgggtgatgaggccttcgcgtcaggccactatcaactcgcc
gcgaagctgttcgcggacatcacgaaggcggaggaactggcggatttcctgacgctgatt
gcgtacgaacatttggagtga

DBGET integrated database retrieval system