KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2550Help
Entry
Tgr7_2550         CDS       T00840                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tgr7_2550
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tgr7_2550
   00630 Glyoxylate and dicarboxylate metabolism
    Tgr7_2550
Enzymes [BR:tgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Tgr7_2550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2689379..2690959
Genome map
AA seq 526 aa AA seqDB search
MHEAVSFTAPIEGFEDLFTPEAVDFLVALHERFAPRVDALLAARKARQARFDAGELPDFL
AETREIRAADWTVGTIPEDLRDRRVEITGPTDRKMLINALNSGAKCFMACLEDAHAPTWR
NGLEGQVNLHDAVTRSIDFTSPEGKHYTLNDQTAVLIVRPRGWHLPEKHMRVNGRAIPGA
LFDFGLYFFHNARTLLDQGTGPYFYLPKLQAHTEARLWNEVFLFAQERLGIPAGTIKVTV
LIETLPAVFELDEILWELKDHIVGLNCGRWDYIFSYIKTFRNHPDRLLPDRAQVSMTVPF
MRAYSQLVIKTCHRRGAFAMGGMAAQIPVRGDEAANETAFAKVRADKEREAKDGHDGTWV
AHPGLVPVAMEVFNTHMPEANQLSRQRPDVNPGRDELIAVPEGTITEAGLRNNINVAIQY
MAAWLGGRGAVPIHNLMEDAATAEISRCQIWQWIRHPGGVLDDGRRVSLEMVERLIPEEM
ETIRQEVGDEAFASGHYQLAAKLFADITKAEELADFLTLIAYEHLE
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaggccgtgagcttcaccgcccccatcgagggcttcgaggacctgttcaccccc
gaggccgtggacttcctggtggccctgcacgagcgcttcgccccccgggtggatgccctg
ctggccgcccgaaaggcgcgccaggcccgcttcgatgccggcgaactgccggacttcctg
gccgagacccgggagatccgcgccgccgactggaccgtcggcaccatccccgaggacctg
cgcgaccggcgcgtggaaatcaccggtcccacggaccgcaagatgctcatcaatgcgctg
aacagcggcgcgaaatgcttcatggcctgcctggaggacgcccacgcccccacctggcgc
aacggcctggagggccaggtgaacctgcacgacgcggtcacgcgcagcatcgacttcacc
tccccggagggcaagcactacacgctcaatgaccagaccgcggtactgatcgtgcgcccc
cggggctggcacctgccggagaagcacatgcgggtgaacggtcgcgccattcccggcgcc
ctgttcgacttcggcctgtacttcttccacaacgcccgcaccctgctggaccagggcacc
ggcccctacttctacctgcccaagctccaggcccacaccgaggcgcggctgtggaacgag
gtgttcctgtttgcccaggagcgcctcggcatccccgccgggaccatcaaggtcacggtg
ctcatcgagaccctcccggcggtgttcgagctggacgagatcctctgggaactgaaggac
cacatcgtcggcctgaactgcggccgctgggattacatcttcagctacatcaagaccttc
cggaatcaccccgaccggctgctgccggaccgcgcccaggtgagcatgaccgtgcccttc
atgcgcgcctattcccagctggtgatcaagacctgccaccgccgcggcgccttcgccatg
ggcggcatggctgcgcagatcccggtgcgcggcgacgaggccgccaacgagacggcgttt
gccaaggtgcgggccgacaaggagcgggaggcgaaggacggccatgacggcacctgggtg
gcgcaccccggactggtgcccgtggccatggaggtgttcaacacgcacatgcccgaggcc
aaccagctgtcgcgccagcgtcccgacgtgaaccccggccgcgacgaactgatcgccgtg
cccgagggcacgatcaccgaggcggggctgcgcaacaacatcaacgtggccatccagtac
atggccgcctggctgggcgggcggggtgcggtgcccatccacaacctcatggaagacgcc
gccaccgccgagatctcccgctgccagatctggcagtggatccgccatccgggcggcgtg
ctggacgacggtcggcgcgtgagcctggagatggtcgagcggctcatccccgaggagatg
gagacgatccgccaggaggtgggtgatgaggccttcgcgtcaggccactatcaactcgcc
gcgaagctgttcgcggacatcacgaaggcggaggaactggcggatttcctgacgctgatt
gcgtacgaacatttggagtga

DBGET integrated database retrieval system