KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2564Help
Entry
Tgr7_2564         CDS       T00840                                 

Definition
(GenBank) Nitrous-oxide reductase
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00910  Nitrogen metabolism
tgr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Tgr7_2564
Enzymes [BR:tgr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Tgr7_2564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX2 UCR_Fe-S_N Cupredoxin_1 TAT_signal
Motif
Other DBs
NCBI-ProteinID: ACL73640
JGI: Tgr7_2564
UniProt: B8GM53
Position
2705669..2707555
Genome map
AA seq 628 aa AA seqDB search
MTKKNDQGTIENPQRRQFLGATAAIGALGAAGASGTGLLMGSRPTAAAQGSNGYSVPLGE
LDDYYGFWSGGHSGEVRILGVPSMREIMRIAVFNFDSATGWGQTNESKRVLGSDFINGDT
HHVHLSYVNGTYDGRFAFTNDKLNTRVARIRLDVMKTDKITHIPNVQAIHGINPQRWPRT
EYLLAAGEMIAPLPNDGRHMDEPEHYWTLLSSLDAETMEIRWQLWVDGNMDNLVTDYTGK
YAGASCYNSERGMTLAEKMGSERDWAVFFNIPAIEAAVAAGDYTTIGDSRIPVVDGRGAD
KGGSKYTLYVPIPRSPHGINATPDKKYVVVSGKLSPTVSVVEWSKVDDWFNGKISDPRDT
IVAEPEVGLGPLHTTFDGRGDAYTSLFLDSQVVKWNIDDAIRAYKGEQVNYIRQKLDVHY
QVGHIMASMCETVEADGRWLVSLNKFSKDRFIPAGPLRPENDQLIDISGAQMKLVHDGPT
YPEPHDSLMVRRDLINPIAIWKRDDPFFAETVAMARADGVNLEQDNKVIRDGNKVRVYMT
SVAPSFGLDHFRVKLGDEVTVVVTNLDNIEDLSHGFALVNYGVNFEISAHQTASATFIAD
KPGVYWYYCSWFCHALHMEMAGRMMVEA
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaaaaacgatcaaggcactatcgagaacccccaacgccggcaattcctgggc
gcgacggcggccatcggagccctgggcgcggcaggcgcaagcggcaccggcctgctcatg
ggcagccgacccactgccgcggcccagggcagcaacggctattccgtgccgcttggcgaa
ctggacgactactacggcttctggagcggcggacactccggcgaggtgcgcatcctgggg
gtgccttccatgcgcgagatcatgcgtatcgccgtgttcaactttgacagcgccaccggc
tggggccagaccaacgaaagcaagcgcgtcctgggcagcgacttcatcaacggcgacacc
catcacgttcacctgagctacgtcaacggcacctacgatggcaggttcgccttcaccaat
gacaagctgaacacccgggttgcccgcatccgcctggacgtgatgaagaccgacaagatc
acccacatccccaacgtgcaggcgatccacggcatcaatccccagcgctggcccaggacc
gagtacctgctcgccgccggcgagatgatcgcccccctgcccaacgacgggcgccacatg
gacgagccggagcactactggacgctgctcagttccctcgacgcggaaaccatggagatc
cgctggcagctgtgggtggacggcaacatggacaacctggtcaccgactacacgggcaag
tacgcaggcgccagctgctacaactccgagcgtggcatgaccctggcggagaagatgggc
tcggagcgtgactgggcggtgttcttcaacatcccggccatcgaggcggccgtcgcggcg
ggggactacaccaccatcggtgactccaggatcccggtggtggacgggcgtggcgccgat
aagggcggctccaagtacacactctacgtaccgatccccagaagtccgcacggcatcaac
gccaccccggacaagaagtacgtggtggtctccgggaagctctcgcccaccgtatccgtg
gtggagtggagcaaggtggacgactggttcaacggcaagatcagtgacccccgggatacc
atcgtggcggaacccgaggtgggcctgggtccactgcataccaccttcgacggacggggc
gatgcctacaccagcctgttcctggacagccaggtggtgaaatggaacatcgacgacgcc
atacgggcctacaagggcgagcaggtcaattacatccgccagaagctggacgttcactac
caggtcggacacatcatggccagcatgtgcgagacggtggaagcggatggacgctggctg
gtgtccctgaacaagttctccaaggatcgtttcattcccgccggacccctgcgtccggag
aacgaccagctcatcgacatctccggagcgcagatgaaactggtgcatgacggccccacc
tacccggagccccatgactcgctcatggtcagacgtgacctgatcaaccccattgccatc
tggaagcgggacgacccgttcttcgctgaaaccgtggccatggccagggcggatggcgtc
aatctggagcaggacaacaaggtcatccgcgacggcaacaaggtccgcgtctacatgacc
tccgtcgcgccctccttcggcctggatcatttccgcgtcaagctgggcgatgaggtcacc
gtggtggtcaccaatctcgacaacatcgaggatctcagccacggtttcgccctggtcaac
tacggcgtcaacttcgagatcagcgcgcaccagaccgcctcggccaccttcatcgccgac
aagcccggggtgtactggtattactgcagctggttctgccacgcgctgcacatggaaatg
gcgggtcgcatgatggtcgaggcctga

DBGET integrated database retrieval system