KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2611Help
Entry
Tgr7_2611         CDS       T00840                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00010  Glycolysis / Gluconeogenesis
tgr01100  Metabolic pathways
tgr01110  Biosynthesis of secondary metabolites
tgr01120  Microbial metabolism in diverse environments
tgr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tgr7_2611
Enzymes [BR:tgr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Tgr7_2611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACL73686
JGI: Tgr7_2611
UniProt: B8GM99
Position
complement(2750877..2751791)
Genome map
AA seq 304 aa AA seqDB search
MSIESLNKRFSNPHVRFSQHEALMMVDLENDHGHASLTTFGATLLSYRPRGGEDVLWVSE
TALYDGKKPVRGGVPVCWPWFGAYDPAALGADPSDAHKKGHGVARYALWDVESVETVGDA
TQVVFVLRPDDEIRKAWPLDFILRLKVSLGQSLEMTLVGENLSDRDWQVSEAFHTYFSVA
DAEGLVVRGLDGTPRVDKLAGGARGVQAGEVRMSMPMEQVFLGHGGPLVIEDRGNGREIV
IERENSASSVLWNPGPEGVKAFADMPDDQYRKTVCVEVANALEDAYALKAGASHAMRMRL
SVRG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcgaatccctgaacaagcgtttttccaatccccatgtgcgcttcagccagcac
gaggcgctgatgatggtggatctggagaacgatcacgggcatgcaagcctgaccaccttc
ggcgccacgctcctgagctaccgtccccggggcggcgaggacgtgctttgggtcagcgag
accgcgctgtatgacggcaagaagccggtgcggggcggggtgccggtgtgctggccgtgg
ttcggggcctacgatcccgctgcgctgggcgcggatcccagcgatgcacacaagaagggc
cacggcgtcgcgcgttatgcgctctgggacgtggagtccgtcgagacggtgggtgatgcc
acgcaggtggttttcgtgctcaggcccgatgacgagatccgcaaggcctggccgctggat
ttcattcttcgcctgaaggtgagcctcggtcagtcactggagatgacgctcgtgggcgag
aacctgagcgatcgtgactggcaggtctccgaggccttccatacctatttcagcgtggcg
gacgccgagggcctggtggtgcgcggtctggacggcacgccccgtgtggacaagctcgcc
ggcggcgcccggggtgtccaggccggtgaggtgcgcatgagcatgcccatggagcaggtg
ttcctgggtcatggcggccccctggtgatcgaggaccggggcaacgggcgcgagatcgtg
atcgaacgggaaaacagcgcgagcagcgtgctatggaatcccggtcccgagggcgtcaag
gcctttgccgacatgcccgacgaccagtaccgcaagaccgtgtgcgtggaagtggccaat
gccctggaggatgcctatgccctgaaggccggggcgagccatgccatgcgcatgcgtctt
tcggtacggggttaa

DBGET integrated database retrieval system