KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2721Help
Entry
Tgr7_2721         CDS       T00840                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00010  Glycolysis / Gluconeogenesis
tgr00052  Galactose metabolism
tgr00500  Starch and sucrose metabolism
tgr00520  Amino sugar and nucleotide sugar metabolism
tgr00521  Streptomycin biosynthesis
tgr01100  Metabolic pathways
tgr01110  Biosynthesis of secondary metabolites
tgr01120  Microbial metabolism in diverse environments
tgr01130  Biosynthesis of antibiotics
tgr01200  Carbon metabolism
Module
tgr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tgr7_2721
   00052 Galactose metabolism
    Tgr7_2721
   00500 Starch and sucrose metabolism
    Tgr7_2721
   00520 Amino sugar and nucleotide sugar metabolism
    Tgr7_2721
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tgr7_2721
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tgr7_2721
Enzymes [BR:tgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tgr7_2721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACL73796
JGI: Tgr7_2721
UniProt: B8GMY1
Position
2864650..2865666
Genome map
AA seq 338 aa AA seqDB search
MHVLAADIGGTKTLIALGRQERGRLHLDTPQRFESAAFPDFETLARTFLKHEGVDPARIS
SACLAIAGPVEGDAERQQARLTNLPWQLDSASLADSLGIARVVLINDFEGVAHSVDDLPA
SSLATLQAGEPDPAGPRLVVGAGTGLGVCAVCANGAGLLPGEGGHAGFSPTDAQQIRLWQ
FVTREEGRCTREHLLSGRGIARIAAFLQTEGHAPGPALAEAMAEGDPAAALSRFALRGDE
PLARETLRLFVRLYGAQTGDLALSVLPTGGVYLAGGIAPRILPLLQNGDFIAAFCRKPPM
SHLLARLPVKVINEPNAGLMGAARWALTSAKGESGSGQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtactggcagccgacatcggtggtaccaagaccctgatcgccctgggccgtcag
gaacgcggccgcctgcacctggacaccccccagcgtttcgagagcgctgccttccccgac
ttcgagaccctggcgcgcaccttcctcaagcacgaaggggtcgatcccgcgcgcatcagc
agcgcctgcctggccatcgccggcccggtggagggcgatgccgagcgtcagcaggcccgg
ctcaccaacctgccctggcagctggacagcgcctccctggccgactcactgggcatcgcc
cgcgtggtgctgatcaatgattttgaaggcgtggcccacagcgtggacgacctgcccgcc
tcctcgctcgccaccctgcaggccggcgaacccgatcccgccggcccgcgcctggtggtg
ggcgccggcaccggtctcggggtctgcgccgtgtgcgccaatggcgcgggcctgctgccc
ggcgaaggtggccatgccggcttctccccgaccgatgcgcaacagatccgcctgtggcag
ttcgtcacccgggaggaaggccgctgcacccgtgaacacctgctctcgggtcggggcatc
gcccgcatcgccgccttcctgcagaccgagggccacgcgcccggccccgccctggccgag
gccatggccgagggcgatcccgccgccgccctgagccgtttcgccctgcgcggcgacgaa
cccctggcccgggagaccctgcgcctgttcgtgcgcctctacggcgcacagaccggcgac
ctggccctgagcgtgctgcccaccggcggcgtatatctcgccggcggcatcgcgccgcgc
atcctgcccctgctgcagaacggcgacttcatcgccgccttctgccgcaagccgcccatg
agccacctgttggccaggctgccggtgaaggtgatcaacgaacccaatgccgggctgatg
ggtgcggcgcgctgggcgctcacaagtgcgaagggtgaatcgggcagtgggcagtaa

DBGET integrated database retrieval system