KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2721Help
Entry
Tgr7_2721         CDS       T00840                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tgr7_2721
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tgr7_2721
   00052 Galactose metabolism
    Tgr7_2721
   00500 Starch and sucrose metabolism
    Tgr7_2721
   00520 Amino sugar and nucleotide sugar metabolism
    Tgr7_2721
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tgr7_2721
   00524 Butirosin and neomycin biosynthesis
    Tgr7_2721
Enzymes [BR:tgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tgr7_2721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2864650..2865666
Genome map
AA seq 338 aa AA seqDB search
MHVLAADIGGTKTLIALGRQERGRLHLDTPQRFESAAFPDFETLARTFLKHEGVDPARIS
SACLAIAGPVEGDAERQQARLTNLPWQLDSASLADSLGIARVVLINDFEGVAHSVDDLPA
SSLATLQAGEPDPAGPRLVVGAGTGLGVCAVCANGAGLLPGEGGHAGFSPTDAQQIRLWQ
FVTREEGRCTREHLLSGRGIARIAAFLQTEGHAPGPALAEAMAEGDPAAALSRFALRGDE
PLARETLRLFVRLYGAQTGDLALSVLPTGGVYLAGGIAPRILPLLQNGDFIAAFCRKPPM
SHLLARLPVKVINEPNAGLMGAARWALTSAKGESGSGQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtactggcagccgacatcggtggtaccaagaccctgatcgccctgggccgtcag
gaacgcggccgcctgcacctggacaccccccagcgtttcgagagcgctgccttccccgac
ttcgagaccctggcgcgcaccttcctcaagcacgaaggggtcgatcccgcgcgcatcagc
agcgcctgcctggccatcgccggcccggtggagggcgatgccgagcgtcagcaggcccgg
ctcaccaacctgccctggcagctggacagcgcctccctggccgactcactgggcatcgcc
cgcgtggtgctgatcaatgattttgaaggcgtggcccacagcgtggacgacctgcccgcc
tcctcgctcgccaccctgcaggccggcgaacccgatcccgccggcccgcgcctggtggtg
ggcgccggcaccggtctcggggtctgcgccgtgtgcgccaatggcgcgggcctgctgccc
ggcgaaggtggccatgccggcttctccccgaccgatgcgcaacagatccgcctgtggcag
ttcgtcacccgggaggaaggccgctgcacccgtgaacacctgctctcgggtcggggcatc
gcccgcatcgccgccttcctgcagaccgagggccacgcgcccggccccgccctggccgag
gccatggccgagggcgatcccgccgccgccctgagccgtttcgccctgcgcggcgacgaa
cccctggcccgggagaccctgcgcctgttcgtgcgcctctacggcgcacagaccggcgac
ctggccctgagcgtgctgcccaccggcggcgtatatctcgccggcggcatcgcgccgcgc
atcctgcccctgctgcagaacggcgacttcatcgccgccttctgccgcaagccgcccatg
agccacctgttggccaggctgccggtgaaggtgatcaacgaacccaatgccgggctgatg
ggtgcggcgcgctgggcgctcacaagtgcgaagggtgaatcgggcagtgggcagtaa

DBGET integrated database retrieval system