KEGG   Thioalkalivibrio sulfidophilus: Tgr7_2932Help
Entry
Tgr7_2932         CDS       T00840                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
tgr  Thioalkalivibrio sulfidophilus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Tgr7_2932
Enzymes [BR:tgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Tgr7_2932
Transfer RNA biogenesis [BR:tgr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Tgr7_2932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3071922..3072752
Genome map
AA seq 276 aa AA seqDB search
MKPDDLPEGLTLEHLRNNACLIARQAGESILAIYEQGFEVLEKDDRSPLTEADMAAHRLI
VSALKELTPGLPVLSEESEQIPYAVRAGWRTYWLVDPLDGTREFVKRNGEFTVNIALIHE
HEPVLGVVHAPVLGVCYRAARGLGAQRIAAEGEPEALHISRRRTRPVVAGSRSHGTERMA
DFLAGLGEHEYLSMGSSLKFCLVAEGRADIYPRLGPTSEWDTAAAQCIVTEAGGQVLDLQ
GHPLSCNTGESLLNPEFIVVGDERWLERLGIVRGEV
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgacgacctgcccgaaggactcaccctggagcacctgcgcaacaatgcctgc
ctgatcgcccgccaggccggcgaaagcatcctggccatctatgaacagggcttcgaggtc
ctggagaaggacgaccgctcgccgctcaccgaggcggacatggcggcccaccgcctcatc
gtctctgcgctgaaggaactgacccccggcctgccggtactctccgaggaatcggagcag
atcccctacgcggtacgcgccggctggcgcacctactggctggtggatccgctggacggc
acccgggagttcgtcaagcgcaacggcgagttcaccgtcaacatcgccctgatccatgag
cacgagcccgtgctcggcgtggtgcacgcgccggtgctgggggtctgttaccgggccgcc
cggggcctgggcgcgcagcgcatcgccgccgagggggaacccgaggccctgcacatcagc
cggcgccggaccaggccggtggtggccggcagccgctcccacggcaccgagcgcatggcg
gacttcctcgccggcctgggcgaacacgaatacctgtccatgggcagttccctgaagttc
tgcctggtggccgaaggccgcgccgacatctacccgcgtctcggccccaccagcgagtgg
gacaccgccgccgcccagtgcatcgtcaccgaggccggcggccaagtgctcgatctgcag
ggccaccccctgagctgcaacaccggcgaatccctgctcaacccggagttcatcgtggtg
ggtgatgagcgctggctggaacggctggggatcgtgcggggagaggtgtga

DBGET integrated database retrieval system