KEGG   Taeniopygia guttata (zebra finch): 100189932Help
Entry
100189932         CDS       T01082                                 

Gene name
UOX
Definition
urate oxidase, pseudogene
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100189932 (UOX)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100189932 (UOX)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     100189932 (UOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 320 aa AA seqDB search
MSQVTINDLEVLNCEYGKNSIKFLRLHKEGKKHFVKEVEVCTHLRLTSPQEYLEGKNSLV
IPTDTIKNIVLVLAKKNGISSLEQFAIDICNHFMTTFCQVAYVKTYIQEVPWQRLHEDGV
PHIHSFICVPDGIRFCEAEQCRNGPLIVFAGIKDLKLMKTTQSGFEGFYKNEHTTLPERH
DRILCGELFCKWSYGECKDFDFDCIWKKIRECILEAFAGPPDCGEYSPSYQKTINCIQML
VLSRVSQVQVIEVVLNNTFFNVVDMKNLGLTNDKEVLVPVEAPYGSCACTLGRKKFFEAQ
GHMMRDERKCQFGLAAAQGN
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagtgacaatcaacgaccttgaagtcctcaactgtgaatatggcaagaattca
attaagttccttcgcctccataaagagggaaagaagcattttgttaaagaagtggaagtg
tgtacgcatctgcggctgacttctcctcaggagtacctggaaggaaaaaattctcttgtg
atacctacggacaccataaagaatattgtccttgtgttggccaaaaaaaatgggatctca
agtttagaacaatttgctatagatatctgcaaccacttcatgacaacattttgccaagtg
gcgtacgtcaaaacctacattcaagaagtaccatggcaacgcctgcatgaggatggcgtt
ccccacatccactcattcatatgtgttcctgatgggatccgcttttgcgaagctgagcag
tgccggaatggtcctctgattgtctttgctggaattaaggacctgaaacttatgaagaca
acacagtctggatttgaaggcttctataagaatgaacacaccacgcttcctgaaaggcat
gacaggattctatgtggagagctcttctgcaaatggtcgtacggcgaatgcaaggatttt
gactttgactgcatatggaagaaaatccgtgaatgtatccttgaagcctttgctggacca
cctgactgtggggaatattcaccttcttaccagaaaactatcaactgtatccagatgctt
gtcctttccagagtgtcacaggtacaggtcatagaagtcgtcttgaacaacacctttttt
aatgttgtagacatgaagaatctaggcttgaccaatgacaaagaagttttggttccagtg
gaagctccttatggctcctgtgcttgcacacttggccgaaagaagttttttgaagcacaa
ggccacatgatgagagatgagaggaaatgtcagtttggactggcagctgcacagggaaac
taa

DBGET integrated database retrieval system