KEGG   Taeniopygia guttata (zebra finch): 100189934Help
Entry
100189934         CDS       T01082                                 

Gene name
MGAM, MG
Definition
maltase-glucoamylase (alpha-glucosidase)
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100189934 (MGAM)
   00500 Starch and sucrose metabolism
    100189934 (MGAM)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100189934 (MGAM)
    3.2.1.20  alpha-glucosidase
     100189934 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 1807 aa AA seqDB search
MGRKFSGLELTLIALFTVVTVIACVLIGLLATGHSGVKSQDSDFHPQCPNTPVAERIDCI
PDQLATQSTCSLRGCCWSPQNDASVPWCFFSPSHGYQVQGSQRSTQAGFEATLERLPAPS
LFGDDIQTVLLTAEYQTKNRFRFKITDPNAQRFEVPHEHVKPFKGSAASSPSYKVELKQN
PFGLVVTRASNGRVLFDTTIGPLQYADQFLQLSIKLPSSNIYGVGEHVHKQYRHDVNWKT
WPIFGRDTAPSAAMDNLYGAHTFFLCLEDNTGASFGVFLMNSNAMEFVVQPAPAVTYRTI
GGILDFYIFLGNTPEQVVQEYLQLVGLPALPAYWNLGFQLCRYGYTSLEEVKTVVERNRA
VGLPHDIQVIDIDYMENRKDFTYDKVKFNGLPQFADYLHKHGQKYIIILDPAISTQKRAD
QSPYGSYVRGTEKNVWVNESDGTALVGEVWPGETVFPDYTSLEATNWWVNECEMFYKEVP
YDGIWIDMNEVCNFVQGSKKGCAENKLNYPPYTPRILDKVMYSKTLCLDAVQSWGKQYDV
HNLYGYSMTLSTRKAIETVFPGKRSFLISRSTFAGSGKHGGHWLGDNAATWDQLRWAIPG
MLEFNLFGIPYVGADICGFTENTTEELCRRWMQVGAFYPFSRNHNAEFVIHQDPAVFGPN
SLLVNSSKHYLNIRYTLLPYLYTLHYKAHTRGDTVVRPLLHEFYSDEITWDIDRQFLWGP
GLLISPALEPGVESTSVYFPDAEWYEYDTGEPMQLKKVWHNIPTPGDKMGLHLRGGYIFP
TQKPNTTTVASRKNPMGLIIALDINNEASGDLFWDDGESTGTIDKKTYIYYEFKVSNNAL
QMTATHSNYADPNKLKFEEIKILGLSKEIGSVSVFQNNVLQNYVSDTTYDPLTKVAVIKG
LQLDLGKSYTIKWTQNTNINERFNCHPGPNATKEKCEQLGCSWEETANPDVPSCYYSSSN
PYLIKNFNYSSTGIVANLSLDDFRVRANDAYTAPIGTLRLEVKYHLNNMLQFKIYDYQNP
RYEVPVPLNLPSSPTSSDMERLYDVSLQIKPFGIQVRRKSTGTVIWNSGLPTFTFSDMFI
QISTRLASQYIYGFGESEHPTFRHNMSWHTWGMFTRDQPPTYKLNSYGVHPFYMALEEDG
NAHGVLLLNSNAMDVTFQPTPALTYRTIGGVLDFYMFLGPTPELVVQEYTQLIGRPFMPP
YWSLGFQLCRYGYGNDSDVAKVVEDMKAAQIPHDVQYVDIDYMDRNLDFTLSPRFAGLPA
LINKIKSEGMRFIIILDPAISGNETDYPAFTRGVANNIFVQWPDTKEILYSKVWSFLPNV
QIDESLPHEELVEKYVSHCAFPDFFRNSTVEWYKREILEVYNNANASISLKFDGLWTDMN
EPAAFMNGAMGGCRNNLLNYPPYMPHLGYRSTGLIHKTPCMEGLHYLPDGTPARHYDVHS
LYGWSQGRPSLEALQGATKERGVVISRSTYPSSGRWVGHWLGDNTAAWDQLHKSIIGMME
FSLFGISYTGADICGFFKDAQYEMCIRWMQLGAFYPYSRNHNEKGTRRQDPASWDEEFKN
MSRKVLNTRYTLLPYLYTLLYNAHAHGSTVVRPILHEFVGDRTTWDIDKQFLWGPALLIS
PVMKENDRSVVAYFPDARWYDYHTNSDTGFRKKFQNLSAPLDHINLHIRGGHILPWQRPA
TRTAYSRKNPMGLTVALDDDLLAEGQLYWDDGVRINAYEDGVYLLTSFTAKQNVLEITVT
HQNYTDPNNLMFTDIKVLGVPSAVTRVTVAQNGTEIASNHTISYKNKLLEITSLQLKLGQ
SYTLKWS
NT seq 5424 nt NT seq  +upstreamnt  +downstreamnt
atgggcaggaagttcagtgggctggagctcactctgattgccctcttcaccgtggtgacg
gtcatcgcctgtgtcctcattgggctgctggccacggggcactccggggtcaaatctcaa
gactcggactttcacccacaatgtccgaatacaccagtagcagagagaattgactgcatc
ccggatcaattagcaacacagagcacctgctccctccgtggctgctgctggagcccccag
aacgacgccagcgtgccctggtgcttcttctcccccagccatggctaccaagtgcagggc
tcccagaggtccacccaggcagggtttgaggccactctggagaggctgccggccccttcc
ctgtttggggacgacatccagaccgtgctgctcacagcggagtatcagacaaagaaccgc
ttccgattcaagatcactgacccgaacgctcaaaggttcgaggtccctcacgagcacgtg
aagccgttcaagggatccgcggcctccagccccagctacaaggtggagctgaagcagaac
cccttcggcctcgtggtgaccagagccagcaatggcagagtgctgtttgacacaaccatt
gggcccctgcagtatgctgaccagttcctgcagctctccatcaaacttcccagcagcaac
atctacggcgtgggggagcacgtgcacaagcagtacaggcacgatgtcaactggaaaacc
tggcctatttttggcagggacactgccccctctgcagcaatggataacttatatggagcc
cacactttcttcttgtgtctggaagacaacactggagcctcctttggtgtcttcctgatg
aacagcaatgccatggagtttgtggtgcagcctgctccagcagtgacctacagaaccatt
ggaggcatcctggatttctacatcttcctggggaacactccagagcaagtagtccaggag
tacctgcagcttgtgggactgccagcactgcctgcctactggaacctgggattccagctc
tgccgctacggatacacctccctggaggaggtgaagacagtcgtggagaggaacagagct
gttgggctgccccacgatatccaagtcattgatattgattatatggagaacaggaaagat
tttacttatgacaaagtgaaattcaatggcctccctcaatttgcagattatttgcataag
catggacaaaaatatatcatcatattggatcctgctattagtacccaaaagagggctgat
caaagtccctatggaagctacgtcagggggacagagaaaaatgtctgggttaatgagtca
gatggaacagcgctggttggagaggtgtggccaggggaaactgtgttcccagactacacc
agcctcgaggccacgaactggtgggtgaacgagtgcgaaatgttctataaggaagtgccc
tatgatggaatatggattgatatgaatgaagtgtgcaactttgttcaaggctcaaaaaaa
ggttgtgcagagaataagttaaactaccctccttacactcccaggattctcgacaaagtc
atgtactccaagacactttgtctggatgcagtgcagagctggggcaagcaatatgatgtc
cacaacctttatggatattccatgaccctatccactaggaaagccattgagacggtgttt
ccaggaaagagaagcttcctgatctcgaggtccacctttgcaggatcaggaaagcacggg
ggacactggctgggggacaatgcagccacgtgggaccagctgagatgggcaatccctgga
atgctggagttcaacctctttggaattccttatgttggagcagatatttgtggtttcact
gagaacaccacagaagaactttgcagacgatggatgcaagtgggagcattttaccccttt
tccaggaaccacaatgctgaatttgtcatacatcaagatccagctgtgtttggacccaac
tccttgctggtgaacagctccaagcattacctgaacattcgctacactttgctgccctac
ctgtacacgctgcactacaaagctcacacccgaggagacacggtcgtgaggccactgctc
catgagttctactctgatgaaataacatgggacatcgacaggcagttcctgtggggccct
gggctgctgatttccccagctcttgagccgggtgtggagtccactagtgtgtactttcct
gatgcagagtggtacgagtatgacacgggtgaaccaatgcaactgaagaaagtgtggcac
aatataccaacccctggagacaaaatggggctgcacctgagaggtggatacattttccct
actcagaaaccaaacaccaccacagtggcaagccgcaagaatccaatgggactcataatt
gccctggatatcaacaatgaagcttctggggatttgttctgggatgatggagaatctaca
ggtacaattgacaagaaaacctacatttactatgaatttaaagtttccaataatgctcta
caaatgactgctacacacagcaattacgctgatccaaacaaactgaaatttgaggaaatc
aagatattgggattgtccaaggaaataggatcagtttctgtgtttcagaacaatgttctg
caaaattatgtctctgataccacctatgatcctttaacaaaggttgctgttataaaagga
cttcagcttgacctgggaaaatcttacacaatcaaatggactcaaaatacaaatatcaat
gaaagatttaattgtcatcctggccctaatgcaacaaaagaaaaatgtgaacaacttggc
tgttcttgggaagagacagcaaatccagatgttccttcctgctactacagctccagcaat
ccttacctcataaagaacttcaattattcctccactggaatcgtggccaacctcagcttg
gacgacttcagggtcagagctaatgatgcttacactgccccaatcggcaccctgcgcctg
gaggtgaaatatcatctcaacaacatgctgcagtttaagatctatgattatcaaaaccca
cgatacgaggtgcccgtgcccctgaacctccccagctcccccacgagctcagacatggag
cggctctacgacgtctcgctccagatcaaacccttcggcatccaagtccgccgcaaaagc
acggggacggtcatctggaattcaggcctgcccaccttcaccttcagtgacatgttcatt
cagatttccacccgcttggcgtcccagtacatctacgggttcggagaatcggagcacccc
acgttccgacacaacatgagctggcacacctggggaatgttcaccagggaccagcctccc
acttacaagttgaattcctatggtgttcacccattttatatggctcttgaagaagatggc
aatgcccacggagttctcttgcttaacagcaatgcaatggatgtgaccttccagcccacc
cctgccctgacctaccgcaccatcggaggagtcctcgacttctacatgtttttgggcccg
actcccgaactcgtggttcaggaatacacccaactgattgggcgcccattcatgcccccc
tactggtccttgggattccagctgtgccgctacggctacggcaacgactcggatgtcgcc
aaggtcgtggaggatatgaaggcggctcagattccccacgatgtccaatatgtagatatt
gactacatggataggaacctggacttcaccctttccccacgttttgctggattaccagct
ctgatcaacaaaatcaaatcagaaggaatgaggtttatcattatcctggatccagcaatt
tctgggaatgaaactgattatcctgccttcaccagaggtgtggccaataacatcttcgtg
cagtggcctgataccaaagaaattttatattccaaggtctggtcgtttcttcccaatgtc
caaatcgacgagtcactgcctcatgaagaactagtagagaagtatgtatcacattgtgct
ttcccagacttcttccgcaattccacagtggagtggtataagagggaaatcctggaggtc
tacaacaatgccaatgcctcaataagcctcaagtttgatggcctgtggactgacatgaat
gaaccggcagcttttatgaatggcgccatgggtggctgtaggaacaacctcctaaattat
cccccctacatgcctcatttgggatataggtcaacaggattaatccacaaaactccgtgc
atggaaggtctgcactacctcccagacgggaccccagccagacactacgatgtccacagc
ctttacggatggtcccaaggcagacccagcctggaggctttgcaaggtgccaccaaggag
cgcggggtcgtcatcagccgctccacctaccccagcagcgggagatgggtgggacactgg
ctgggggacaacacggcagcctgggaccagctgcacaaatccattattggcatgatggag
ttcagtctctttggaatatcttatacaggagctgatatctgtggcttcttcaaagacgcg
cagtatgagatgtgcatccgctggatgcagctgggtgcattttacccatattcgaggaat
cacaatgagaaaggaacacggaggcaagatccggcttcctgggatgaggaatttaaaaat
atgtccaggaaggtgctgaacacaagatacaccctgttaccttatctctacaccttgctg
tacaacgcccatgcccacggcagcaccgtggtccgcccaattctccacgagtttgtgggc
gacaggaccacgtgggacatcgacaaacagttcctctggggtcctgccctgctcatcagc
cctgtgatgaaagagaatgatcggagcgtggtcgcttatttccccgatgcccgctggtat
gattaccacacaaactcagatactggatttaggaaaaaattccaaaatttatcagctcct
ttggatcacatcaacctgcacatccgaggtggacacatcctgccttggcaaagacctgct
actagaacagcttacagccggaagaacccgatgggactgacggtggccctggatgatgat
ctgcttgcagaaggacaactttattgggatgatggggttcgcatcaatgcatatgaagat
ggtgtttacctgctgacatcatttactgctaagcagaatgttctggagatcacagtgaca
caccagaactacacggaccccaacaacctgatgttcactgacatcaaagtcctgggggtg
cccagcgctgtcactcgggtgacagtggcacagaacgggacggaaatcgcatcaaaccac
acaatcagctataaaaacaagctcctggaaatcaccagtctccagctgaaactgggccag
agctacaccctgaagtggagctag

DBGET integrated database retrieval system