KEGG   Taeniopygia guttata (zebra finch): 100189975Help
Entry
100189975         CDS       T01082                                 

Gene name
EIF4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  
translation initiation factor 4E
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100189975 (EIF4E)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100189975 (EIF4E)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100189975 (EIF4E)
Messenger RNA biogenesis [BR:tgu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100189975 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100189975 (EIF4E)
Translation factors [BR:tgu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100189975 (EIF4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 217 aa AA seqDB search
MAAVEPETTPNPQPAEEEKTEPTPSQEVASPEQYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRTKGDKIAIWTTECENRDAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggaaccggaaaccactcccaacccccaacctgcagaagaggagaaaacc
gagccaacacctagtcaggaggttgccagccctgagcagtatattaaacatccactacaa
aacagatgggcactctggttttttaaaaatgacaaaagcaaaacttggcaagcaaatctt
cgtcttatctcaaagttcgatactgttgaggatttttgggctttatacaaccatatccag
ctctctagtaatttaatgcctggttgtgactactcgctctttaaggatgggattgaaccc
atgtgggaagatgaaaagaacaagcgaggaggccgatggctaattacactaaacaagcag
cagagacgaagtgaccttgatcgcttctggctagagacactgctgtgccttattggggag
tcattcgatgactacagtgatgatgtgtgtggtgctgttgttaatgttagaactaagggt
gataaaatagcaatatggacaactgaatgtgaaaacagggatgctgttacgcatataggg
agagtatacaaggaaagattaggacttcctccaaagatagtgattggttatcagtcccat
gcagacacagctactaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system