KEGG   Taeniopygia guttata (zebra finch): 100190013Help
Entry
100190013         CDS       T01082                                 

Definition
protein phosphatase 1 catalytic subunit alpha-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
mRNA surveillance pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100190013
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100190013
  Cell growth and death
   04114 Oocyte meiosis
    100190013
  Cellular commiunity
   04510 Focal adhesion
    100190013
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100190013
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100190013
   04270 Vascular smooth muscle contraction
    100190013
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100190013
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100190013
Protein phosphatases and associated proteins [BR:tgu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100190013
Transcription machinery [BR:tgu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100190013
Spliceosome [BR:tgu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100190013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 342 aa AA seqDB search
MADTEKLNLDSIISRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPAGRPVTPPRNSAKAKASGRFSFDSFFYL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaccgagaagctcaacctcgactccatcatcagccgcctcctggaggtccaa
gggtcgcggccggggaagaacgtgcagctgacagagaacgagatccgcgggctgtgcctc
aaatcccgggagatcttcctgagccagcccatcctgctggagctggaggcacccctcaag
atctgcggtgacatccacgggcagtactacgacctcctgaggctctttgagtacgggggc
ttcccccctgagagcaattacctgtttttgggcgactacgtggaccggggcaagcagtcc
ctggagaccatctgcctgctgcttgcctacaaaatcaagtaccccgagaacttcttcctg
ctgcggggcaaccacgagtgtgccagcatcaaccgcatctatggcttctatgatgagtgc
aaacgaagatacaacatcaagctctggaagaccttcaccgactgcttcaattgtttgccc
attgctgccatcgtggatgagaagatcttctgctgccacggagggctgtccccagacctg
cagtcgatggagcagatccggcggatcatgcggcccacggatgtcccggatcaggggctg
ctctgtgacctgctctggtccgaccccgacaaggacgtgcagggctggggggagaacgac
cgtggggtctccttcaccttcggggccgaggtggtggccaaattcctgcacaagcacgac
ctggatctcatctgccgggcgcaccaggtggtggaggatggctacgagtttttcgccaag
cgccagctcgtcaccctcttctcggcccccaactactgcggcgagtttgacaacgccggc
gccatgatgagcgtggatgagaccctcatgtgctctttccagattttgaagccggccgac
aagaacaaaggcaaatatgggcagttcagcgggctgaaccccgccgggcgccccgtcacc
cctccccgaaactctgccaaagccaaagcatcaggtcgcttttctttcgactcgtttttt
tatttgtag

DBGET integrated database retrieval system