KEGG   Taeniopygia guttata (zebra finch): 100190233Help
Entry
100190233         CDS       T01082                                 

Definition
palmitoyl-protein thioesterase-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100190233
  Lipid metabolism
   00062 Fatty acid elongation
    100190233
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100190233
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100190233
Lipid biosynthesis proteins [BR:tgu01004]
 Fatty acid synthase
  Component type
   100190233
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
23
AA seq 292 aa AA seqDB search
MAALMAAVPLLALLSLLALCPGPAAAAAPLVIWHGMGDSCCNPVSMGYIQKLVEKKIPGI
YVLSLKIGSSLIQDMENSFFMNVNEQVREVCGQLAADPRLQGGYNAMGFSQGGQFLRAVV
QRCPAPPMLSLISIGGQHQGVYGFPRCPGESSHLCDWIRKTLDLGAYTKAVQEHLVQAEY
WHDPLKEEDYRKNSIFLADINQERGINETYKKNLMALKKFVMVKFLNDTMVDPPISEWFG
XLQKWPSQGDHPAAGDLTVQRGSPGAAGDGQSREVGVPGGEGGSPALLRRVV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctcatggcggcggtgccgctgctggcgctgctgtcgctgttggcgctgtgt
ccgggccccgcggccgccgccgcgcccctggtgatctggcacggcatgggtgacagctgc
tgcaatccggtgagcatgggctacatccaaaaattggtggagaaaaaaatccctgggatt
tacgtcctgtcgctgaagatcgggagcagcctgatccaggacatggagaacagcttcttc
atgaacgtcaacgagcaggtgagggaggtgtgtgggcagctggccgccgacccccggctg
cagggcggctacaacgccatgggcttctcccagggaggccaattcctgagggctgtggtc
cagaggtgccctgctcctcccatgctcagcctgatctccatcgggggacagcaccaaggg
gtgtacggcttcccacgctgccccggggagagctcccacctctgcgactggatccgaaaa
accctggatctgggagcctacaccaaggctgtgcaggagcacttggtccaagcagagtat
tggcacgacccgctgaaggaggaggactacaggaaaaacagcattttcctggctgacatc
aatcaggagaggggcatcaacgagacctacaagaaaaacctgatggctctgaaaaagttt
gtgatggtgaaattcctcaacgataccatggtggaccctccaatctctgagtggtttggg
nttttacaaaagtggccaagccaaggagaccatcccgctgcaggagacctcactgtacaa
agaggatcgcctggggctgcaggagatggacaaagcagggaagttggtgttcctgggggt
gaagggggatcacctgcacttctcagaagagtggtttga

DBGET integrated database retrieval system