KEGG   Taeniopygia guttata (zebra finch): 100190233Help
Entry
100190233         CDS       T01082                                 

Definition
palmitoyl-protein thioesterase-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tgu01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:tgu00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:tgu04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
23
AA seq 292 aa AA seqDB search
MAALMAAVPLLALLSLLALCPGPAAAAAPLVIWHGMGDSCCNPVSMGYIQKLVEKKIPGI
YVLSLKIGSSLIQDMENSFFMNVNEQVREVCGQLAADPRLQGGYNAMGFSQGGQFLRAVV
QRCPAPPMLSLISIGGQHQGVYGFPRCPGESSHLCDWIRKTLDLGAYTKAVQEHLVQAEY
WHDPLKEEDYRKNSIFLADINQERGINETYKKNLMALKKFVMVKFLNDTMVDPPISEWFG
XLQKWPSQGDHPAAGDLTVQRGSPGAAGDGQSREVGVPGGEGGSPALLRRVV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctcatggcggcggtgccgctgctggcgctgctgtcgctgttggcgctgtgt
ccgggccccgcggccgccgccgcgcccctggtgatctggcacggcatgggtgacagctgc
tgcaatccggtgagcatgggctacatccaaaaattggtggagaaaaaaatccctgggatt
tacgtcctgtcgctgaagatcgggagcagcctgatccaggacatggagaacagcttcttc
atgaacgtcaacgagcaggtgagggaggtgtgtgggcagctggccgccgacccccggctg
cagggcggctacaacgccatgggcttctcccagggaggccaattcctgagggctgtggtc
cagaggtgccctgctcctcccatgctcagcctgatctccatcgggggacagcaccaaggg
gtgtacggcttcccacgctgccccggggagagctcccacctctgcgactggatccgaaaa
accctggatctgggagcctacaccaaggctgtgcaggagcacttggtccaagcagagtat
tggcacgacccgctgaaggaggaggactacaggaaaaacagcattttcctggctgacatc
aatcaggagaggggcatcaacgagacctacaagaaaaacctgatggctctgaaaaagttt
gtgatggtgaaattcctcaacgataccatggtggaccctccaatctctgagtggtttggg
nttttacaaaagtggccaagccaaggagaccatcccgctgcaggagacctcactgtacaa
agaggatcgcctggggctgcaggagatggacaaagcagggaagttggtgttcctgggggt
gaagggggatcacctgcacttctcagaagagtggtttga

DBGET integrated database retrieval system