KEGG   Taeniopygia guttata (zebra finch): 100190331Help
Entry
100190331         CDS       T01082                                 

Gene name
EIF3J
Definition
(RefSeq) eukaryotic translation initiation factor 3, subunit J
  KO
K03245  
translation initiation factor 3 subunit J
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100190331 (EIF3J)
Ribosome biogenesis [BR:tgu03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    100190331 (EIF3J)
Translation factors [BR:tgu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100190331 (EIF3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 251 aa AA seqDB search
MAAEAADSWDADSFEVVEPVAKRLVPGVAGDRWAGEDEEDDVKDNWDDEEEEEEVKETEV
KQEPKVSEKKKIAEKIKEKEKLQKKKQEELKKRLEAPEEQKELTPEEQLADKLRLKKLQE
ESDLELAKETFGVNSTCGIDAMNPSSKDDFTEFGKLLKEKITQYEKSLHYAGFLEALLRD
VCISLEVDDLKKITNTLTVLCSEKQKQEKNKAKKKKKGVVPGGGLKATMKDDLADYGGYD
GEYVQDFEDFM
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggaggcggcggactcgtgggacgccgacagcttcgaggtggtggagccggtg
gcgaagcggctggtgccgggggtggccggggaccgctgggccggcgaggatgaggaggac
gacgtgaaggataactgggatgatgaggaggaagaggaggaggtgaaggagacagaggta
aaacaagaaccgaaagtttcagaaaaaaagaaaatagcagaaaaaatcaaagaaaaagaa
aagctacagaagaaaaagcaagaggagcttaaaaaaaggttagaggcacccgaggaacag
aaggagctcacaccagaagaacagttggcagacaaactacggctaaagaagttacaagag
gagtcagacctggagctggcaaaggaaaccttcggtgtaaatagcacttgtggaatagat
gccatgaatccctcttcgaaagacgacttcacggaatttgggaagctgctgaaggagaag
atcacacagtacgagaagtccttacattacgccgggtttttggaagcgctgcttcgggac
gtctgcatttccttggaggtggatgatttgaaaaagatcacaaacactctgacagtatta
tgcagtgaaaaacaaaaacaagagaagaataaagccaaaaagaagaaaaaaggggttgtg
cctggcggggggctgaaggcgacgatgaaagacgacctggctgactacggcggctacgac
ggcgagtacgtacaagactttgaagacttcatgtga

DBGET integrated database retrieval system