KEGG   Taeniopygia guttata (zebra finch): 100190410Help
Entry
100190410         CDS       T01082                                 

Definition
guanylate kinase protein-like
Organism
tgu  Taeniopygia guttata (zebra finch)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 41 aa AA seqDB search
MLVNLSSTRSSPGICTGQVKGPCRPCRPRTRSVSSMSTSRA
NT seq 126 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgaatttatcgagcacgcggagttctccgggaatatgtacgggacaagtaaag
gggccgtgcaggccgtgcaggcccagaaccagatctgtgtcctcgatgtcgacatccagg
gcgtga

DBGET integrated database retrieval system