KEGG   Taeniopygia guttata (zebra finch): 100190600Help
Entry
100190600         CDS       T01082                                 

Definition
Lysozyme C-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100190600
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100190600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
26
AA seq 149 aa AA seqDB search
MRKSMLFLGFLVFLGLALPGTQGKIIPRCEMVKILRQNGFQGFEGTTVADWMCLVKHESD
YNTKAYNDNGPSRDYGIFQINSKYWCNDGKTSGSKNACKISCSKLQDDNLGDDIQCAKKI
AREAHGLSPWYGWKNHCRGKDLSSFVRGC
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtcaatgctcttccttggctttcttgttttccttggcctggctctgccaggc
acccagggaaaaataattcccagatgtgagatggtgaagattctacgtcagaatggcttt
cagggcttcgagggcacaactgttgctgactggatgtgcctggtgaaacatgagagtgat
tataacacgaaagcgtacaatgacaatggtccaagcagggactacggcatcttccagatc
aacagcaagtactggtgcaacgatggcaagacctctggatccaagaatgcctgcaaaatc
agttgctcaaaactgcaagatgataatcttggggatgatattcagtgtgccaagaagatt
gcccgcgaggctcatggcctcagtccctggtatggctggaaaaaccattgccggggcaaa
gacctgagttcctttgtcaggggctgctaa

DBGET integrated database retrieval system