KEGG   Taeniopygia guttata (zebra finch): 100190600Help
Entry
100190600         CDS       T01082                                 

Definition
Lysozyme C-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
26
AA seq 149 aa AA seqDB search
MRKSMLFLGFLVFLGLALPGTQGKIIPRCEMVKILRQNGFQGFEGTTVADWMCLVKHESD
YNTKAYNDNGPSRDYGIFQINSKYWCNDGKTSGSKNACKISCSKLQDDNLGDDIQCAKKI
AREAHGLSPWYGWKNHCRGKDLSSFVRGC
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtcaatgctcttccttggctttcttgttttccttggcctggctctgccaggc
acccagggaaaaataattcccagatgtgagatggtgaagattctacgtcagaatggcttt
cagggcttcgagggcacaactgttgctgactggatgtgcctggtgaaacatgagagtgat
tataacacgaaagcgtacaatgacaatggtccaagcagggactacggcatcttccagatc
aacagcaagtactggtgcaacgatggcaagacctctggatccaagaatgcctgcaaaatc
agttgctcaaaactgcaagatgataatcttggggatgatattcagtgtgccaagaagatt
gcccgcgaggctcatggcctcagtccctggtatggctggaaaaaccattgccggggcaaa
gacctgagttcctttgtcaggggctgctaa

DBGET integrated database retrieval system