KEGG   Taeniopygia guttata (zebra finch): 100190660Help
Entry
100190660         CDS       T01082                                 

Gene name
GPX1
Definition
glutathione peroxidase 1 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100190660 (GPX1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100190660 (GPX1)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100190660 (GPX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 197 aa AA seqDB search
MAAAGAGAGAARLAELSAKPLGAAKPLSLGSLRGKVLLVVNVASLUGTTTRDFLQLNELQ
QRYGPRGLQVLGFPCNQFGHQENGTNDEILPMLEHVRPGNGYKPNFTMFEKCEVNGKDAH
PLFTFLKEALPFPHDDPSSLMTNPQYIIWSPVCRNDIAWNFEKFLIGPDGVPFKRYSRRF
ETIKIQDDIELLLQKVA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgggagcaggtgcgggcgcggcgaggctggcggagctgtcggcgaagccc
ctgggcgcggcgaagccgctctcgctgggctcgctgcggggcaaggtgctgctggtggtc
aatgtggcgtcgctctgaggcacgacaacgcgcgacttcctgcagctcaacgagctgcag
cagcgctacggcccccgcgggctccaggtcctcggcttcccctgcaaccagttcggtcac
caggaaaacggcaccaacgatgagatccttcccatgcttgagcacgttcgtcctggcaac
gggtacaagcctaatttcaccatgttcgagaagtgcgaggtgaacgggaaggatgcgcac
cccctgttcaccttcctgaaagaggcgctgcccttcccgcacgacgacccctcctcgctg
atgaccaacccgcagtacatcatctggtccccggtgtgccgcaacgacatcgcctggaac
ttcgagaagttcctcattggccccgacggtgtgcccttcaaacgctacagccggcgtttc
gaaaccatcaagatccaggacgacattgagttgcttctgcagaaggttgcctag

DBGET integrated database retrieval system