KEGG   Taeniopygia guttata (zebra finch): 100190751Help
Entry
100190751         CDS       T01082                                 

Gene name
PPP1CC
Definition
(RefSeq) protein phosphatase 1, catalytic subunit, gamma isozyme (EC:3.1.3.16)
  KO
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
mRNA surveillance pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Insulin resistance
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100190751 (PPP1CC)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100190751 (PPP1CC)
  Cell growth and death
   04114 Oocyte meiosis
    100190751 (PPP1CC)
  Cellular commiunity
   04510 Focal adhesion
    100190751 (PPP1CC)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100190751 (PPP1CC)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100190751 (PPP1CC)
   04270 Vascular smooth muscle contraction
    100190751 (PPP1CC)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100190751 (PPP1CC)
  Infectious diseases
   05168 Herpes simplex infection
    100190751 (PPP1CC)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100190751 (PPP1CC)
Protein phosphatases and associated proteins [BR:tgu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100190751 (PPP1CC)
Transcription machinery [BR:tgu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100190751 (PPP1CC)
Messenger RNA biogenesis [BR:tgu03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100190751 (PPP1CC)
Spliceosome [BR:tgu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100190751 (PPP1CC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 323 aa AA seqDB search
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNSSRPVTPPRGMITKQAKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggatatcgacaagctcaacatcgacagcatcatccaacggctgctggaggtgcga
ggatcaaaaccaggcaaaaacgtccaacttcaagagaatgagattagaggactgtgcttg
aaatccagagaaatcttcctgagtcagcctattctactagaacttgaagctccactgaaa
atctgtggtgacatccatggacaatactatgacttgctccgactctttgaatatgggggt
tttccaccagagagcaactacctgttccttggtgattatgttgacagaggaaaacaatct
ttagaaacaatttgtcttctattggcctacaaaattaaatacccagagaattttttcctc
ctccgagggaaccacgaatgtgccagcatcaatagaatttatgggttttatgatgaatgt
aagcgaagatacaatattaagctgtggaaaaccttcacagactgttttaactgtttacca
attgcagctattgtggatgagaaaatattctgctgtcacgggggtttgtcaccagacctg
cagtcaatggagcagatcagacgaatcatgcgccccacggatgtaccggatcaaggtctc
ctgtgtgatctcctgtggtctgaccctgacaaggatgtcttgggctggggtgaaaatgac
agaggagtgtccttcacttttggtgctgaagtggttgctaagtttctccataaacatgat
ttggatctcatatgtagagctcatcaggtggttgaagatggatatgaattttttgcaaaa
agacagttggtaactctcttttctgccccaaattactgtggagaatttgataacgcgggt
gccatgatgagcgtggatgaaacactaatgtgctctttccagatcttgaaacctgcagag
aagaagaagcccaattccagcagacctgtaacacctcccaggggcatgatcacaaaacaa
gccaagaaatag

DBGET integrated database retrieval system