KEGG   Taeniopygia guttata (zebra finch): 100190752Help
Entry
100190752         CDS       T01082                                 

Definition
thymosin beta 4-like
Orthology
K05764  
thymosin, beta 4
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100190752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaaaccagacatggctgagatcgagaaatttgacaagtccaaattgaagaag
acagagacgcaagagaaaaatccgctgccttcaaaagaaacaattgaacaggagaagcaa
gcgggtgaatcgtaa

DBGET integrated database retrieval system