KEGG   Taeniopygia guttata (zebra finch): 100190753Help
Entry
100190753         CDS       T01082                                 

Definition
(RefSeq) triosephosphate isomerase-like
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00010  Glycolysis / Gluconeogenesis
tgu00051  Fructose and mannose metabolism
tgu00562  Inositol phosphate metabolism
tgu01100  Metabolic pathways
tgu01200  Carbon metabolism
tgu01230  Biosynthesis of amino acids
Module
tgu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tgu_M00002  Glycolysis, core module involving three-carbon compounds
tgu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100190753
   00051 Fructose and mannose metabolism
    100190753
   00562 Inositol phosphate metabolism
    100190753
Enzymes [BR:tgu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100190753
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100190753
  Exosomal proteins of bladder cancer cells
   100190753
  Exosomal proteins of melanoma cells
   100190753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 100190753
NCBI-ProteinID: NP_001232159
UniProt: B5KFL8
AA seq 216 aa AA seqDB search
MAPRKFFVGGNWKMNGDKKSLGELIHTLNSAKLSADTEVVCGAPAIYLDFARQKLDAKIG
VAAQNCYKVPKGAFTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIGQKVAHALAEG
LGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPQQ
AQEVHEKLRGWLKSHVSDAVAQSTRIMYGGSVTGSN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaggaagttcttcgtggggggcaactggaagatgaacggcgacaagaagagc
ctgggcgagctcatccacacgctgaatagcgccaagctctccgccgacaccgaggtggtt
tgtggagcccctgccatctacctagactttgcccgtcagaagctcgatgcaaagattgga
gtggcagcacagaattgttataaagtgccaaaaggagctttcacaggagagatcagccca
gcaatgatcaaggatattggagctgcatgggtgatcctaggccactcagagcgaaggcat
gtttttggagagtctgatgagttgattggacagaaggtggctcatgctctggctgagggc
cttggagtcattgcctgtattggagagaagctggatgagagagaagctggcataacagag
aaagtggtttttgaacagaccaaggctattgctgataatgtgaaggactggagtaaagtg
gttcttgcctatgagccagtttgggctattggaactggtaaaactgcaactccccaacag
gctcaggaagttcatgagaagctgcgggggtggctgaaaagccacgtgtctgatgctgtt
gctcagtcaactaggattatgtatggaggttctgtcactggcagcaactga

DBGET integrated database retrieval system