KEGG   Taeniopygia guttata (zebra finch): 100190753Help
Entry
100190753         CDS       T01082                                 

Definition
triosephosphate isomerase-like
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100190753
   01230 Biosynthesis of amino acids
    100190753
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100190753
   00051 Fructose and mannose metabolism
    100190753
   00562 Inositol phosphate metabolism
    100190753
Enzymes [BR:tgu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100190753
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100190753
  Exosomal proteins of bladder cancer cells
   100190753
  Exosomal proteins of melanoma cells
   100190753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 216 aa AA seqDB search
MAPRKFFVGGNWKMNGDKKSLGELIHTLNSAKLSADTEVVCGAPAIYLDFARQKLDAKIG
VAAQNCYKVPKGAFTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIGQKVAHALAEG
LGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPQQ
AQEVHEKLRGWLKSHVSDAVAQSTRIMYGGSVTGSN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaggaagttcttcgtggggggcaactggaagatgaacggcgacaagaagagc
ctgggcgagctcatccacacgctgaatagcgccaagctctccgccgacaccgaggtggtt
tgtggagcccctgccatctacctagactttgcccgtcagaagctcgatgcaaagattgga
gtggcagcacagaattgttataaagtgccaaaaggagctttcacaggagagatcagccca
gcaatgatcaaggatattggagctgcatgggtgatcctaggccactcagagcgaaggcat
gtttttggagagtctgatgagttgattggacagaaggtggctcatgctctggctgagggc
cttggagtcattgcctgtattggagagaagctggatgagagagaagctggcataacagag
aaagtggtttttgaacagaccaaggctattgctgataatgtgaaggactggagtaaagtg
gttcttgcctatgagccagtttgggctattggaactggtaaaactgcaactccccaacag
gctcaggaagttcatgagaagctgcgggggtggctgaaaagccacgtgtctgatgctgtt
gctcagtcaactaggattatgtatggaggttctgtcactggcagcaactga

DBGET integrated database retrieval system