KEGG   Taeniopygia guttata (zebra finch): 100192322Help
Entry
100192322         CDS       T01082                                 

Gene name
TPM1
Definition
tropomyosin 1 (alpha)
Orthology
K10373  
tropomyosin 1
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    100192322 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    100192322 (TPM1)
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100192322 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEERSKQLEDELVALQKKLKATEDELDKY
SESLKDAQEKLELADKKATDAESEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAQKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIIESDLERAE
ERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcaagaagaagatgcagatgctgaagctggacaaggagaacgccttggac
agagccgagcaagccgaagcggacaagaaggcagcggaggagagaagcaagcagctggag
gacgagctggtggctctacaaaagaagctgaaggccactgaggatgagctggacaaatac
tccgagtcccttaaagatgcacaggaaaagttggaactggctgacaaaaaggccacagat
gctgagagtgaagtagcttctctgaacagacgcatccagctggttgaggaagagttggat
cgggctcaggagcgcttggccactgccctgcagaagctggaggaggctgagaaggctgca
gatgagagtgaaagaggaatgaaggtcattgaaaatagagcccagaaggatgaagagaag
atggaaatccaggagatccagcttaaagaggctaagcacattgctgaagaggctgaccgc
aagtatgaagaggtggctcgtaagctggtgatcattgagagtgacctggagcgcgctgag
gagcgtgctgagctatcagaaagcaaatgtgctgagcttgaagaggagttgaaaactgtg
accaacaacctgaagtcgctggaggctcaggctgagaagtactcacagaaagaagacaag
tatgaagaggagattaaagttctgactgacaaactgaaggaggctgagacccgtgctgag
tttgctgagaggtcagtaaccaagctggagaagagcattgatgacctagaagatgagctc
tatgctcagaaactgaagtacaaagccatcagtgaggagctggaccacgctctcaatgat
atgacttccatataa

DBGET integrated database retrieval system