KEGG   Taeniopygia guttata (zebra finch): 100192322Help
Entry
100192322         CDS       T01082                                 

Gene name
TPM1
Definition
tropomyosin 1 (alpha)
Orthology
K10373  
tropomyosin 1
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Class
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:tgu04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:tgu04261]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEERSKQLEDELVALQKKLKATEDELDKY
SESLKDAQEKLELADKKATDAESEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAQKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIIESDLERAE
ERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcaagaagaagatgcagatgctgaagctggacaaggagaacgccttggac
agagccgagcaagccgaagcggacaagaaggcagcggaggagagaagcaagcagctggag
gacgagctggtggctctacaaaagaagctgaaggccactgaggatgagctggacaaatac
tccgagtcccttaaagatgcacaggaaaagttggaactggctgacaaaaaggccacagat
gctgagagtgaagtagcttctctgaacagacgcatccagctggttgaggaagagttggat
cgggctcaggagcgcttggccactgccctgcagaagctggaggaggctgagaaggctgca
gatgagagtgaaagaggaatgaaggtcattgaaaatagagcccagaaggatgaagagaag
atggaaatccaggagatccagcttaaagaggctaagcacattgctgaagaggctgaccgc
aagtatgaagaggtggctcgtaagctggtgatcattgagagtgacctggagcgcgctgag
gagcgtgctgagctatcagaaagcaaatgtgctgagcttgaagaggagttgaaaactgtg
accaacaacctgaagtcgctggaggctcaggctgagaagtactcacagaaagaagacaag
tatgaagaggagattaaagttctgactgacaaactgaaggaggctgagacccgtgctgag
tttgctgagaggtcagtaaccaagctggagaagagcattgatgacctagaagatgagctc
tatgctcagaaactgaagtacaaagccatcagtgaggagctggaccacgctctcaatgat
atgacttccatataa

DBGET integrated database retrieval system