KEGG   Taeniopygia guttata (zebra finch): 100217503Help
Entry
100217503         CDS       T01082                                 

Gene name
AOX1
Definition
aldehyde oxidase 1
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100217503 (AOX1)
   00350 Tyrosine metabolism
    100217503 (AOX1)
   00380 Tryptophan metabolism
    100217503 (AOX1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100217503 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    100217503 (AOX1)
   00830 Retinol metabolism
    100217503 (AOX1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100217503 (AOX1)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100217503 (AOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 1342 aa AA seqDB search
MALQGAAAAEELVFYVNGRKIIEKNADPEQMLLAYLRKRLCLTGTKYGCGGGGCGACTVM
ISIYEPASKKIRHYSANACLLPICSLYGAAVTTVEGVGSTKSRIHPVQERLAKCHGSQCG
FCTPGMVMSIYTLLRNHPEPTSEQMIAALAGNLCRCTGYRPILDACKTFCKESICCQRKT
NGKCCLDQEDDLFDNEEEVPTSLFSTDEFQPLDPTQELIFPPELMRMAENQPKQTLFFRG
ERVTWISPVSLVELLDLKAAYPKAPLVVGNTSVGPDMKFRGVFHPVLIAPARIPDLNVLK
YTNDGLTLGAACSLSLVKDILTNAIAEFPEEKTRVFCAVLQQLRTLGGEQIRNVASFGGN
IISRKPTSDLNPVLAASNCMLNLASRGQRRQILLSDIFADGVGNNTITPEEILVSIHVPY
SRKGEYVSAFRQAPRRENALPITNAGMRVLFEEGTDVIKELSIFYGGALSATVCAKQTCC
TLTGRHWNEQMLDEACRLVLKEITLPGSAGDENVDYKKTLMVSFFYRFFLEVSQSLKTMN
PCHYPGIPVEYGSVLQDFKTRMPQSIQIYQDVEPSQSPQDPVGRPVMHQSAIKHATGEAV
YIDDLPSVDGELFLAAVTSSRAHAKIVSIDTSEALKVAGVFDVITAHDVPAANEFHFSDD
PEIIFARNEVICVGQIVCAVVADSDVHAKQAAAKVKIEYEVLEPVILTIEEAIKHNSFFE
PKRKLEQGNVDEAFETVDNIVEGEICIGGQKHFYMETQSMLAVPKGEDKEMDLYVSTQHP
AIIQEMVAASLGVPANRIMCHVKRVGGAFGGKILRTGLLASVAAVAANKTSRAVRLILSR
EDDMVILGGRHPFMAKYKVGFMNDGRITAVDAKYYVNGGCTPDESVLVAEISLLKMDNAY
KIPNLRCWAYVCKTNLPSNTAFRGFGFPQSGLVTETWITDIADKTGLSPEKIRETNMYKK
NEQTHFKQKLDPQNLIRCWNECMEKSAYYSRRTAINEFNKQNYWKKRGIAIVPMKFPFGL
STPYLSQGAALVHIYTDGSVLLTHGGIEMGQGIHTKMIQIASRELNIPMSCIHFCETSTT
TVPNACASVGSAGTDVNGMAVKDACQTLLKRLQPIIEKNPTGTWNDWIREAFKQSVSLSA
TGYFRGYNEYMDWEKGEGQPFTYFLFGAACSEVEINCLTGDHKNLRTDIVMDIGCSINPA
VDIGQIEGAFVQGVGLYTMEELKYSSEGALYTRGPDQYKIPAVCDIPEQFSVSLLSPSQN
PYAIYASKGIGEAGFFLGCSVFFALRDAVTGVRNERGLKKTFALNSPLTAEQIRANCADA
FTQMMENNEASSLGHICVNDKP
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcaaggggccgcggcggctgaggagctcgtcttctatgtcaatgggaggaag
ataatagagaaaaatgctgatcctgaacaaatgctcttggcttatctgcgaaagaggctc
tgtcttacaggaactaagtatggctgtggaggaggtggctgtggtgcttgcacagtgatg
atatcaatttatgaaccagcttcaaagaagatacgacactattcagccaatgcatgtttg
cttcctatttgctccttgtacggtgcagcagtgactacagtggaaggtgttggaagtaca
aaaagcaggattcatccagttcaggaaagacttgccaagtgtcatggctcccagtgcggt
ttctgcacacctggaatggtgatgtccatatacactttgttaagaaaccacccagaacca
acttcagagcagatgattgcagctctggctgggaacttgtgccgctgtactggatacagg
ccaatcctagatgcctgtaaaaccttctgtaaggaatccatctgttgtcaaaggaaaaca
aatggaaaatgttgcttggatcaagaagatgatttgtttgacaatgaagaggaggtgccc
accagcctgttttcaacagatgaattccagcccttagatcccacccaggagcttatattc
cctccagaactaatgagaatggcagaaaatcaaccaaaacaaactctgttttttcgtggg
gagcgagtaacatggatttctcccgtaagcttggttgaactgctggatctgaaagctgcc
taccctaaagcacctcttgtggttgggaacaccagtgtgggacctgacatgaaattcaga
ggtgtgttccatccagtccttattgctcctgcaaggatcccagatctgaatgtgctgaaa
tacacaaatgatggattaactctgggagctgcctgcagcctctctctggtgaaagacatc
ttgacaaatgcaattgccgagttccctgaagagaagacgagggttttctgtgctgtctta
cagcaactgagaactctgggcggagaacagataagaaatgttgcttcatttggtggaaac
atcataagtagaaaaccaacctcagacttgaatcctgttctggcagccagcaactgcatg
ctcaatctggcttcaagaggacaaaggcgacagattcttctgagtgatatttttgcagat
ggagttggtaacaataccattacaccagaagagatcttagtctctatccatgttccctat
tctaggaagggggagtatgtctctgcatttcgacaagcaccaagacgggaaaatgctctt
ccaataaccaatgctgggatgagggtcctttttgaagaaggtacagacgttataaaggag
ctgagcattttctatggaggtgctctctcagcaaccgtctgtgcgaaacaaacctgttgc
acacttactggaagacactggaatgaacagatgttggatgaagcatgcagactagttctt
aaagaaattactcttccaggctcagctggtgatgaaaatgtagactataagaaaactttg
atggtcagtttcttctacagatttttcctggaagtatcacagtcattgaagacaatgaat
ccttgccattatcctggcattcctgtggaatatgggagtgtcctacaagatttcaaaacc
agaatgccccagagcatccaaatatatcaagatgtagagccgagccagtctccccaggac
cctgtaggacgacccgttatgcaccagtctgcgataaagcacgccactggtgaagcagtc
tacattgatgaccttccttctgtggatggagagcttttcctggctgctgtcactagttcc
agagctcatgcaaagattgtatctatagatacctcagaggccctaaaagtagcaggtgtg
tttgatgtcataacagctcatgatgtgccagctgctaatgagtttcatttttctgatgat
ccggagattatatttgcaagaaatgaggtgatttgcgtgggtcagattgtctgtgctgtg
gtcgcagattcagatgttcatgccaaacaagcagctgcaaaagtgaagatagagtatgaa
gtgctggaaccagtaattttaacaattgaggaagctataaaacacaactcattctttgag
ccaaaaagaaaattagaacaaggaaatgttgatgaggcatttgaaactgttgataatata
gttgaaggggagatttgcattggcggacagaaacacttttacatggagactcagagtatg
cttgctgttccaaaaggagaggataaagaaatggatttgtatgtgtcaacacaacatcca
gcaattattcaggagatggtagctgcgagtttaggtgttccagccaacaggatcatgtgc
cacgttaaacgagttggtggagcttttggtgggaaaatcctgagaactggcttactggca
tcagttgctgcagtggcagcaaacaaaaccagcagagcagtccgtcttattctgagccga
gaggatgatatggtaatccttggtggccgacatccttttatggctaaatataaagttggc
ttcatgaatgatggtaggatcacagctgtggatgccaaatattatgttaatggaggatgt
acccctgacgaatctgttctggtagcagaaatatccttattaaaaatggacaatgcatac
aagattcccaacctgagatgctgggcttatgtctgcaaaacaaatttgccgtcaaataca
gcattccgaggctttggctttcctcagtcaggactggtgacagaaacttggataacagac
attgcagataaaactggtttatcaccagaaaagattagggaaacaaatatgtataagaag
aatgaacagacacacttcaaacaaaaacttgatccacagaatttgatacggtgttggaac
gaatgtatggagaaatctgcatactacagtaggagaacagctatcaatgaatttaacaaa
caaaattactggaagaaaagagggattgccattgtaccaatgaaatttccatttggacta
agcacaccttacctttctcagggtgctgcactggttcatatttatactgatgggtctgtg
cttctgacacatggtggaattgaaatggggcagggtattcatacaaaaatgatccagatt
gctagtcgggaattgaacatccccatgtcatgtatccacttctgtgaaacgagcacaaca
actgttcccaatgcatgtgcctcggtgggatctgcagggacagatgtcaatggcatggct
gtgaaggatgcttgccaaactcttctgaaacgcctgcagcccatcattgagaagaaccca
acagggacctggaatgattggattagagaagcttttaaacagagtgtgagcctttcagct
actggctattttagaggttacaatgaatacatggactgggagaaaggggaaggacagcca
ttcacatattttctctttggagctgcttgttcagaggttgaaattaactgtctaacagga
gatcacaagaacctcagaacagacattgttatggacattggatgcagcataaatccagct
gtggatataggacagattgaaggtgcttttgttcaaggcgttggactgtacacaatggag
gagttaaagtattcttcagaaggagccctctatactcggggtccagatcagtataagatc
cctgctgtttgtgatattccagaacagttcagtgtttccttgctgtcaccttctcaaaat
ccttatgccatctatgcatccaaggggataggtgaggcaggatttttcttgggatgctct
gtgttcttcgctttgagggatgcagtaacaggtgtgaggaatgaaagaggactgaaaaag
acctttgcactgaacagccccctgactgctgagcaaatacgggcaaactgcgctgatgcc
tttactcagatgatggaaaacaatgaagcttcctccttgggccacatctgtgtgaatgac
aaaccatag

DBGET integrated database retrieval system