KEGG   Taeniopygia guttata (zebra finch): 100217557Help
Entry
100217557         CDS       T01082                                 

Gene name
UGP2
Definition
(RefSeq) UDP-glucose pyrophosphorylase 2
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100217557 (UGP2)
   00052 Galactose metabolism
    100217557 (UGP2)
   00500 Starch and sucrose metabolism
    100217557 (UGP2)
   00520 Amino sugar and nucleotide sugar metabolism
    100217557 (UGP2)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100217557 (UGP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 508 aa AA seqDB search
MSALLQDFSKAMSQAGSSQFQEVIRQELEYSMKVELDKILATAHSNEIEHTKKDLEGFKK
LFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNIASVLNKLVVVKLNGGLGTS
MGCKGPKSLIGVRNENTFLDLTVQQIEHLNKSYNTDVPLVLMNSFNTDDDTKKILQKYSH
SRVKIYTFNQSRYPRINKETLLPIAKDVSYSGENTECWYPPGHGDIYASFYNSGLLDNLI
AEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEN
KLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWIALSAIKRLQEKNAIDMEIIVNPKTLD
GGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSE
KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIA
NHGDRIDIPAGALLENKIVSGNLRILDH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctctcctgcaagatttcagcaaagcaatgtctcaagctggctcctcacagttt
caggaagtcattcggcaggagctggagtattcaatgaaagtagaactcgataagatcctt
gcaactgcacactcaaatgagatagagcacactaagaaggacctggaaggatttaagaag
ctgtttcatagattcctacaagaaaagggaccatctgtggactgggggaagattcagaga
cctccagaagattctatccagccctatgagaagatcaaggccagaggcctgcctgataac
attgcttctgtcttgaacaagctggtggtggtgaagctgaatggtggcctgggcaccagc
atgggctgcaaaggccccaagagcctgatcggggtgcggaacgagaacaccttcctggac
ctgacagtgcagcagatcgagcatttaaacaaatcctacaacaccgatgttcctctggtt
ctcatgaattccttcaacacagacgatgacacaaagaaaatcctgcagaaatacagtcac
agccgtgtgaagatttatacttttaatcaaagcaggtatcccagaattaacaaggaaact
ctgctgccaatagccaaggatgtctcttactcaggagagaacacggagtgctggtaccct
ccaggccatggagacatctacgccagcttctacaactccgggctgctggacaacctcatt
gcagaggggaaggaatatatttttgtgtccaatatagataatttgggtgccactgtggac
ctttacattcttaaccacctcatgaacccacccaatggaaaacgctgtgaatttgtcatg
gaagtcacaaacaagacccgggcggatgtgaagggtggcacgctgacacagtacgagaac
aagctgaggctggtggagatagctcaggtccctaaagcacacgtggatgagttcaagtct
gtgtcaaaattcaaaatattcaacaccaacaatctgtggattgctctgtctgcaattaag
aggctgcaagaaaaaaatgccattgacatggagatcattgttaacccaaagactctggat
ggaggcttgaacgttatccagctggagaccgcagttggtgctgctatcaagagttttgag
aactctctgggtatcaacgtgcctcgcagccgtttcctgcccgtgaagaccacctcggat
ctcctgctggtgatgtccaacctgtacagccttaacgcggggtcgctgaccatgagcgag
aagcgcgagttccccacagtgcctcttgtcaagctgggaagctccttcacaaaggttcaa
gattacctgcggaggtttgaaagtattccagatatgctggagctggatcacctcacggtt
tcaggtgatgttacatttgggaagaatgtttcattaaagggaacagtgatcatcattgca
aaccacggtgacaggattgacatcccggctggagctctactagagaacaaaatcgtgtct
ggcaacctgcggatcctggaccactga

DBGET integrated database retrieval system