KEGG   Taeniopygia guttata (zebra finch): 100217568Help
Entry
100217568         CDS       T01082                                 

Gene name
NLK
Definition
(RefSeq) nemo like kinase
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
tgu04068  FoxO signaling pathway
tgu04310  Wnt signaling pathway
tgu04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100217568 (NLK)
   04310 Wnt signaling pathway
    100217568 (NLK)
   04068 FoxO signaling pathway
    100217568 (NLK)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    100217568 (NLK)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100217568 (NLK)
Protein kinases [BR:tgu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100217568 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 100217568
NCBI-ProteinID: XP_004177060
Ensembl: ENSTGUG00000008692
Position
19
AA seq 527 aa AA seqDB search
MSLCGTTANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHAQHHLHAGSAAA
VHPVQQHASSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAA
VKAHHHQHSQHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPITNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcacaacagccaacgcaaaaatgatggcggcttacaatggcggtacg
tctgcggcagcagcaggtcaccaccaccaccatcaccaccaccttcctcacctccctcct
cctcacctccatcaccaccaccatgctcagcaccacctgcacgccggctcggcggccgcg
gtgcaccccgtgcagcagcatgcctcctcggccgccgcggccgccgcagccgcggccgcc
gccgccgcgatgttgaacccagggcagcagcagccgtacttcccatccccggccccgggc
caggcccccggaccggctgcagcagccccagctcaggtacaggctgcagcagctgctgca
gtcaaagcgcaccatcatcagcactcacaacatccacagcagcaactggacattgagccg
gacagacccatcggatacggagcctttggtgttgtctggtcagtaacagatccacgagat
ggaaagagagttgcactcaaaaagatgcccaacgtcttccagaatttggtctcttgtaaa
agggtcttccgggagttgaagatgttgtgtttttttaagcatgacaatgtactctctgcc
ctcgacatcctccaacctccacacatcgactattttgaagaaatatatgttgtcactgag
ttgatgcagagtgacctccataagattatcgtctctcctcagccactcagctcggatcat
gtcaaagtttttctttaccagattttaagaggtctgaaatatctacattctgctggcatt
ttacatcgagacattaaaccagggaacctacttgtgaacagcaactgtgtccttaagatt
tgtgattttggattggccagggtggaagagttagacgaatcccggcacatgactcaggaa
gttgtcactcagtattaccgcgctccggagatcctgatgggcagccggcactacagcaat
gccatcgacatctggtctgttggctgcatctttgcagagttgcttggcagaaggatcttg
ttccaggcacagagtcccatccagcagctggatctgatcacagacctgctgggcacgccg
tcactggaggcgatgaggacggcttgtgaaggcgccaaggcacacatactcaggggtcct
cataaacagccatcccttcctgtcctatatacactctccagtcaagctacacatgaagca
gttcatctcctttgcaggatgctggtctttgatccatccaaaaggatatctgctaaggat
gccttagctcacccctacctggatgagggccgcttgcggtaccacacctgtatgtgcaaa
tgttgtttctccacttcgactggcagagtttataccagtgattttgagcccatcactaat
cccaaattcgatgacacttttgagaagaacctcagttctgttcggcaggttaaagaaata
attcatcagttcattttggaacagcagaaaggaaacagagtgcctctctgcatcaaccct
cagtctgctgcttttaagagctttattagctccacggtcgcccagccctccgagatgccg
ccgtcgccgctggtgtgggagtga

DBGET integrated database retrieval system