KEGG   Taeniopygia guttata (zebra finch): 100217569Help
Entry
100217569         CDS       T01082                                 

Gene name
PRKAA1
Definition
protein kinase, AMP-activated, alpha 1 catalytic subunit
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100217569 (PRKAA1)
   04150 mTOR signaling pathway
    100217569 (PRKAA1)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    100217569 (PRKAA1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100217569 (PRKAA1)
   04920 Adipocytokine signaling pathway
    100217569 (PRKAA1)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100217569 (PRKAA1)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   100217569 (PRKAA1)
Mitochondrial biogenesis [BR:tgu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100217569 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    100217569 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Z
AA seq 561 aa AA seqDB search
MRRLGPCLKMAAVADKQKHEHGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKIL
NRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICK
NGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDG
EFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKIC
DGIFYTPQYLNPSVISLLKHMLQVDPMKRATIRDIREHEWFKQDLPKYLFPEDPSYSSTM
IDDEALKEVCEKFECTEEEVLSCLYSRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPP
DSFLDDHHLSRPHPERVPFLVAEAPRPRHTLDELNPQKSKHQGVRRAKWHLGIRSQSRPN
DIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSAYSKMSLQLYQVDSRTYLLDFRSID
DEIAEVKSGTATPQRSGSVSNYKSCPKDSDADAQGKSADTSLTSSVNSSLDSSTADVTPR
PGSHTIEFFEMCANLIKILAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggctcggcccttgcctcaagatggcggcggtggcggataaacagaagcacgag
cacggccgggtgaagattgggcattatatcctgggcgacacgctgggcgtcggcaccttc
gggaaagtcaaggttggaaaacatgagttaactgggcataaagttgccgtgaagatcctg
aatcgacagaagattcgcagccttgatgttgtaggcaaaatccgcagggagattcagaac
ctcaaactcttcaggcatcctcatataattaagctgtaccaagtcatcagtacacccact
gacattttcatggtgatggaatatgtttcaggaggagaactgtttgattatatctgtaaa
aatggaaggcttgatgagaaagaaagtagacgtttatttcagcaaatcctttctggtgtg
gattactgtcacaggcacatggtagtacatagagatctgaagcctgaaaatgtgcttctt
gatgcacatatgaatgccaagatagctgactttggtctatcaaatatgatgtcagatgga
gaatttttaagaacaagctgtggttcccctaactatgctgcaccagaagtaatttctgga
aggttatatgcaggtccagaagtagatatttggagcagtggggttattctctatgctttg
ttatgtggaacgcttccatttgatgatgatcatgtgccaaccctttttaagaagatatgt
gatggtatcttttatacccctcagtacctgaatccatctgtaattagtctcttgaagcac
atgctgcaagtggatccaatgaaaagagcaacaatcagagacattagggaacatgaatgg
tttaaacaggatcttccaaaatacttgtttcctgaagatccatcttacagttctactatg
attgatgatgaagccttaaaagaagtgtgtgagaagttcgaatgcactgaagaggaagta
ctaagttgtctgtacagccgaaatcatcaggaccctctagctgttgcttatcaccttatt
atagataacagaagaataatgaacgaggccaaagacttctacttggccacaagtccacca
gattcttttctggatgatcaccacctgtctcgccctcaccctgaacgagtgccattttta
gtagcggaagcaccacgtcctcgccacacccttgatgagctgaatccacagaaatcaaaa
caccaaggtgtaagacgggctaaatggcacttgggaatacggagtcagagtcgaccaaat
gatattatggctgaagtttgcagagcaattaaacagctggattatgaatggaaggttgta
aatccatattatctgcgtgttcggaggaagaatccagtaacaagtgcatattccaaaatg
agtctccagttgtatcaggtggacagcagaacatacttactggacttccgtagtattgat
gatgaaattgctgaagtgaagtctgggactgcaactccacagagatcaggttctgtgagc
aactataaatcttgtccaaaagattcagatgctgatgcccaaggaaaatctgcggataca
tcccttacctcatcagtgaactcttcgcttgactcttccacagctgatgtaactccaaga
ccagggagtcatacaattgagttttttgagatgtgtgcaaatcttattaagatacttgca
cagtaa

DBGET integrated database retrieval system