KEGG   Taeniopygia guttata (zebra finch): 100217579Help
Entry
100217579         CDS       T01082                                 

Gene name
USP36
Definition
ubiquitin specific peptidase 36
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100217579 (USP36)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100217579 (USP36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 1079 aa AA seqDB search
MIAEKLREALEPGRREAAAELGRPLAAAARSVLQQRIEFAPARRGLAGQLEHLRDKYEHI
GAEVLGRPLGIAGSFPERPQKLPGHSHALPRAAGDGIPAPQKVLFPPQSLSMKWERVHRV
GAGLSNLGNTCFLNSALQCLTYTPPLTNYLLSREHGRTCAHGSFCMMCTMQNHMIQTFAN
SGNAIKPLSIIRDLKKISHNLRFGRQEDAHEFLRYTIDAMQKACLNGYTKLDRQTQATTL
VHQIFGGYLRSRVKCLECKTVSDTYDPYLDVTLEVERAANIVRALELFVKPEQLGGDNAY
RCSMCRKKVLASKRFTIHRASNVLTISLKRFGSCSSSGGRKITKDVGYPEFLDIRPFMSE
PKGDPITYGLYAVLVHSGYSCNAGHYFCYVKASNGQWYRMNDHEVHPSNIKVVLNQQAYV
LFYLRLGSPRKSSAGPMATAAFSPPSCTASDSKAVKKPEINRTLCVPPIGLKQDKLLGKQ
LPGSGDVGVPVARSSPGMGSKLTNGIALSKPPFQTPSSKLPHKATHEATLLGCDTVQRPK
KPQTPGMPRGGFHATSTMCRAKTGLPPQGSDSEKPPTSSKLLKSSQEPSVCGAMARTLKK
SSSTVGQLAKENHRAKSNSSSFCTSQGRDSGIHLPAGSGTKLAGCKDSDLAAPKSSRTAP
VTPSPPGSAVLKWGSTMAPLLARKPLLSAKKGKPSQKVSMSDHQAQCQPSATTHPDSTPR
PLGKSSSRETGSGQEEPEGSFKKKRRKRKHRSADRNPCAVAVKGMDEVSSPPKKERVISP
EVFKDKDSRLPKKESTDSQKDFIDEDTRPPKKKVASPGDFVSVMGKEVASEGLSHDLVCQ
DMKSGPKQHVPEPSTGLGMEPTSPLKRKKKKKNRSKDRLLKKTEECSSGMLPSDSSRTSE
PEPCKTHQSVEAGEHKHRKRKWMESLSSLAANTVPTATATTPVAAHPSDNQTGDERCSLA
ALSPVASSWAGTAPEGQESSVVDKLLQNSLDRAYGKQVLTWQGEISAVSQDAIRDTALAQ
SKTVIDDWDQEFDKGKVKKMKKMRQERRRDSNPFQKLQNKRNFWLMSHPAKMASLGHRL
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcggagaagctgcgggaggcgctggagccggggcggcgggaggcggcggcggag
ctgggccggccgctggccgccgccgcccgctccgtgctgcagcagcgcatcgagttcgcg
cccgcccgccgcggcttggccgggcagctggagcacctgcgggacaagtacgagcacatc
ggggccgaggtcctcggccgccccctcggcatcgccggcagctttccggagcggccgcag
aagctccccggacacagccatgccctgccgagggccgcgggtgacgggatccccgcgccg
cagaaggtgctcttcccaccgcagagcctctccatgaagtgggagcgggttcaccgtgtg
ggcgccgggctgagtaacctggggaacacctgcttcctgaactccgcgctgcagtgcctg
acctacacgccaccactcaccaactacctgctctcccgggagcacggacgcacctgtgcc
catggaagcttctgcatgatgtgcactatgcagaaccacatgattcagacttttgccaac
agcggaaatgcaataaagccactctccatcatccgagacctcaagaagatttcccataac
ttgcgcttcggtaggcaggaggatgcacacgagttcctgcgttacaccatcgatgccatg
cagaaggcctgcctgaatggctacaccaagttggatcgacagacccaggccacaactctg
gttcaccagatctttggtggttacctgcggtcccgtgtgaaatgcttggagtgcaagact
gtctcggatacctatgacccttacttggacgtgacactggaggttgagcgagccgcaaac
atcgtgcgggccttggagctgtttgtcaagccagagcagctgggtggggacaacgcttac
aggtgcagcatgtgcaggaagaaagtgttggccagcaaacgtttcaccatccaccgagcc
tccaacgttctcacaatttcactgaaacgctttggcagttgcagctcctcaggtggaagg
aaaataaccaaggacgtgggatacccagagttcttggacatccggcctttcatgtctgag
cccaagggtgatcccatcacgtatggactttatgcagtgctggtacactctgggtacagc
tgcaacgcagggcactacttctgctacgtgaaggccagcaatgggcagtggtatcgaatg
aatgaccatgaggtccaccctagcaacatcaaggtggttctcaaccagcaggcctatgtg
ctgttctacctgaggctgggcagccccaggaagagctcagcagggcccatggccacggct
gccttcagcccgcccagctgcactgccagtgactccaaggcagtgaagaaacctgagatt
aacaggaccctgtgtgtgccaccgataggcctgaaacaagacaaactgctggggaagcaa
ctgccaggctctggagatgttggagtccctgttgcccgcagctctcctggcatggggtcg
aagctgacaaatggaattgctctgtcaaagccaccctttcagaccccatcatccaaactg
ccccacaaagccacccacgaggccacactgctgggctgtgacacagtccagaggcccaag
aagccacagacccctggcatgcccagaggaggcttccatgccaccagcaccatgtgcagg
gccaaaacagggctgcccccacagggctcagacagtgagaagccacctacctcatccaag
ctgctgaagtccagccaggagcccagtgtctgtggggcaatggccaggaccctgaagaag
agttccagcacagtagggcagctggccaaggagaaccacagggccaagagcaattccagc
agcttctgtacctctcagggaagggactctggcatccacctccctgctggctctggcacc
aagctggctggctgtaaagactctgacctggctgcccccaaaagctccaggacagcccct
gtgacaccctccccgccgggcagcgccgtgctgaagtggggcagcaccatggcaccactg
ctggccaggaagccactgctctcagccaaaaagggcaaaccctctcagaaggtgagcatg
agtgatcaccaagcacagtgccagccctcagccaccacccaccctgactctactcctagg
cctctgggaaagtccagcagcagggagacaggatctggccaggaggaaccagagggttcc
ttcaaaaagaagcgtcggaagaggaagcatcgtagcgcagacaggaacccttgtgctgtg
gctgtgaagggcatggatgaagtctccagtcctcccaagaaggagagagttatttctcca
gaggtcttcaaggacaaagactccaggctccccaagaaagagagcactgactctcagaag
gacttcattgatgaagataccaggcctcccaagaagaaagttgcctctccaggggacttt
gtgtctgtcatggggaaggaggtggccagtgagggtctcagccatgacctggtctgtcag
gacatgaagagtgggcccaagcaacatgtgccagagcccagtactggcctgggcatggag
ccaacttcacccctcaagaggaagaagaagaaaaagaataggagcaaagacaggcttttg
aagaagacagaagagtgcagctctgggatgctgccttcggacagctccaggacaagtgaa
ccagagccctgtaagacacatcagagcgtggaggctggagagcacaagcaccgcaaacgc
aagtggatggaaagcctcagtagcctggctgccaacactgttcccaccgccactgccact
accccagtggcagcacatcccagtgacaaccagactggggatgagaggtgctccctggct
gccctgagccctgtggccagcagttgggctggcacagcccctgagggccaggagtccagc
gtggtggacaagctgctccagaattccttggacagggcttatggcaagcaagtcttgacc
tggcagggtgagatttcggccgtgagccaggatgcaattcgggacacagcactggcccaa
agcaagaccgtcatcgatgactgggaccaggaatttgacaaaggaaaggtaaagaaaatg
aagaagatgaggcaggagcggaggagagactcaaatccattccagaagttgcagaacaag
cgcaacttctggttgatgtcacatcctgccaagatggccagtctgggccaccggctctaa

DBGET integrated database retrieval system