KEGG   Taeniopygia guttata (zebra finch): 100217611Help
Entry
100217611         CDS       T01082                                 

Gene name
PNPLA7
Definition
(RefSeq) patatin-like phospholipase domain containing 7
  KO
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100217611 (PNPLA7)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100217611 (PNPLA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
17
AA seq 1299 aa AA seqDB search
MLTGIAIGAAVALLLIAVIVFVVYRRVRQSKQLQPHVPQYRFRKRDKVMFYGRKIMRKVT
TLPNSLVGNTVPRQRMRKRAKVLSLAKRILRIKKECPTLQRKEPPPSLLEADLTEFDVKN
SHLPSEVLYMLKNVRVLGHFEKPLFLELCKHMFFVQLHEGEYIFRPGQLDNSIYVVQDGK
LEVCIQENDGTEVVVKEVLAGDSVHSLLSILDVITGHPAPYKTVSARAATPSTILRLPAS
AFQDVFQKYPETLVRVVQIIMVRLQRVTFLALHNYLGLTTELFSCQSQGTPLISVSSVTA
GGSAGKAGKRPTPNALEEDRGEKFEKSGEALEMDMLRISGTENSEHVFRRSLSSPPYAGS
TEASNNASGAKSDMDMAYERARVQLVPEDAAGSPAVAKSILKKTVTVTETPSAVFHYSAV
QDSCNSKHVDAIVEAAKKDLSALMKLDNPALLNGKVTLHQVTAGTVLSRQGDQDVNVCFV
VSGMLHVYQRKIDSEEDTCLFITHPGELVGQLAVLTGEPLIFTIKANRDCSFLSISKSHF
YEIMREQPSVVLGVAHTVVKRMSPFVRQIDFALDWMEVEAGRAVYRQGDKSDCTYIVLNG
RLRSVLRMDDGKKHLTGEYGRGDLIGVVEALTHQPRATTVHAVRDSELAKLPEGALISIK
RKFPQVVTRLIHLLGEKILGSLQQGGHPLGLHSSSSKWDAGNPASNLSTVAIMPVSEEVP
LTAFTLELKHALSAVGPALLLTSDNIKQRLGSAALDSIHEYRLTSWLGQQEDIHRIVLYQ
ADSTLTPWTQRCIRQADCILIVGLGDQEPSVGELERMLENTAVRAQKQLILLHKEDGPLP
SRTVEWLNMRSWCSAHLHIHCPRRVFSKRSLPKLVEMYERVFQKAPDRHSDFSRLARVLT
GNAIALVLGGGGARGCSQVGVIRALIEAGIPVDMIGGTSIGAFMSALYAEERSYNQMRIK
ARQWAMVMNSVFKTILDLTYPITSMFSGAAFNNSINNIFKDKQIEDLWIPYFTITTDITA
SAMRVHRDGSLWRYVRASMSLSGYMPPLCDPKDGHLLMDGGYINNLPADVARSMGAKVVI
AIDVGSRDETDLTNYGDCLSGWWLLWKRWNPLAEKVKVLNMAEIQTRLAYVCCVRQLEMV
KNSDYCEYIRPPIDRYGTLDFGKFDEICEVGYQHGKTVFNVWCRSGVLDKMLKDRQETCK
SKTDNVTCPTTSFTDLAEIVSRIEPVKAPLADDESDYQTEYEEEVLDSQKDDYLDFISNQ
AEEDSDSDEEMHLRRRRNVPGGEALFIYLILQQTKTMLR
NT seq 3900 nt NT seq  +upstreamnt  +downstreamnt
atgctgactggaattgcaattggagctgcagttgcactgttgcttatagcagttattgtg
tttgtcgtgtacagaagagtgagacaatctaaacaacttcagccacacgtgcctcagtac
aggtttcgcaagagggacaaagtgatgttctacgggaggaagatcatgaggaaggttaca
actcttcccaactctctggttgggaacaccgtccctcgccagaggatgcggaaacgggca
aaggttttatctctggctaaaaggattctgcgtattaagaaggaatgtccaactctgcag
aggaaagaacctcctccttctttgctagaggcagatctgactgaatttgatgttaagaat
tcccacttgccatcagaagtcctgtacatgcttaaaaatgtcagggtccttgggcacttt
gagaagcccctgttcctggagctgtgcaagcacatgttctttgtgcagctgcacgagggc
gagtacatcttccgtcccgggcagctggacaacagcatctacgtggtgcaggatggaaag
ctggaagtttgcatccaagaaaatgatggaacagaggtggtggtgaaggaggtgctggca
ggagacagcgtgcacagcctgctgagcatcctggatgtcatcacgggtcaccctgctccc
tataaaacggtctcagcccgagcagccactccatccacaatactgaggcttccagccagt
gccttccaggatgtgttccagaaataccctgaaacccttgtgagagtggtgcagatcatc
atggtgaggctgcagagggtgacattcctggccttgcacaactacctggggctgaccaca
gagctcttcagctgtcagagccagggcacccctctgatctccgtgagcagtgtcaccgct
ggcggcagcgccggcaaggcgggcaagagaccaacgcccaatgctttggaggaggatcgt
ggagagaagtttgaaaagtctggggaagccctggaaatggatatgttgagaatttctggt
acagaaaactctgagcatgttttcagaagaagcctttcatcacctccctatgcaggctct
acagaggcttctaacaacgccagcggagccaagtccgacatggacatggcctacgagagg
gcgcgggtgcagctggtccccgaggacgccgccggcagccccgccgtggccaagtcgata
ttgaagaagactgtgacagtgacagaaactccttcagcagttttccattacagtgctgtg
caggactcctgtaacagcaaacacgttgatgccattgtggaagcagcaaagaaagacctc
tcagccctgatgaaacttgataatcctgcattgctgaatggcaaagtgacactgcatcag
gtcactgctggcactgtgctgtccaggcagggagatcaggatgtcaatgtttgctttgtg
gtctcggggatgctccatgtgtaccagaggaagattgactctgaggaggacacctgcctc
ttcatcacccaccccggggagctcgtgggccagctcgctgtcctcactggggagcccctg
atcttcaccatcaaggccaacagagactgcagcttcctctccatctccaagtcccatttc
tatgagattatgcgggagcagcccagtgtggtgctgggggtggcccacactgttgtgaag
agaatgtccccctttgtcaggcaaattgacttcgccctggactggatggaggtcgaggct
ggacgagctgtttacaggcagggggacaagtctgactgcacgtacatcgtgctgaacggc
cgcctgcgctccgtgctgcgcatggacgacggcaagaagcacctgaccggggagtacggc
cggggggacctcatcggagtggtggaagccctgacccaccagcccagagccaccacggtg
cacgcggtgcgggactcggagctcgccaagctcccggagggggccctgatctccatcaaa
cgcaaattcccccaggttgtgaccagacttattcacttgctgggtgagaagattcttggc
agtctgcagcagggaggtcatcctcttggactgcacagctccagcagcaagtgggatgca
gggaatcctgccagcaacctctccacggtggccatcatgccggtgtccgaggaggtgccg
ctgacagccttcaccctggagctcaagcacgccctcagtgctgtgggtcctgccctgctg
ctcaccagtgacaacatcaaacagcgcctgggctctgctgctctcgacagcatccacgag
tacagactgaccagctggctgggccagcaggaggacatccacaggattgtgctgtaccag
gctgacagcaccctgaccccctggacccagcgctgcatccgccaggccgactgcatcctc
atcgtggggctgggagaccaggagccctctgtgggagagctggagaggatgctggagaac
acggcagtgagagcccagaagcagctgatcctgctccacaaggaggatgggcccctcccg
tcccgcacggtggagtggctcaacatgaggagctggtgttctgctcacctccacatccac
tgcccacgcagagtcttctccaaaaggagtctgcccaagctggtggagatgtatgaacgt
gtgttccagaaggctccagaccgccactccgacttctcccgcctggcccgggtcctgacg
ggcaacgccatcgcgctggtgctgggcggcggcggggccaggggctgctcccaggtgggc
gttatccgggcgctgatcgaggctggaattcccgtggacatgatcgggggcacgtccatc
ggcgccttcatgagcgccctgtacgccgaggagcgcagctacaaccagatgaggatcaaa
gctcgccagtgggccatggttatgaactcggtgtttaagactattctagacttgacatac
ccaataacctctatgttttctggagcagcttttaacaacagcatcaacaacatcttcaaa
gataaacagatagaggatctgtggattccttacttcaccatcaccactgacatcactgcc
tcggccatgagggtgcacagggatggctccctgtggaggtacgtccgggccagcatgtcc
ctctcggggtacatgcctcccctctgtgaccccaaggatggccatctcctcatggatggg
ggctacatcaacaacctgccagctgacgtggccaggtccatgggggccaaggtggtgatc
gccatcgacgtgggcagccgcgacgagaccgacctgaccaactacggcgactgcctgtcc
ggctggtggctgctctggaagaggtggaaccccctggctgagaaagtcaaggtgctgaac
atggctgagatccagaccaggctggcctatgtgtgctgcgtgcggcagctggagatggtg
aagaacagcgactactgcgagtacatccggccccccatcgaccgctacggcaccctggac
ttcggcaagttcgacgagatctgtgaagtgggataccagcatgggaaaactgtatttaat
gtgtggtgcaggagtggagtccttgacaagatgctgaaggacaggcaagagacctgcaaa
tccaaaactgataacgtgacctgtcccaccacgtccttcacagacctggccgagatcgtg
tcccgcatcgagcccgtcaaggctccgctggcagacgatgagtcagactaccagactgag
tatgaggaagaagttctggacagccagaaggatgattacctcgatttcataagcaaccag
gctgaggaagactctgactcggatgaggagatgcacctgaggaggcgcaggaatgtgcct
ggtggggaggccctatttatttatttaatacttcagcaaaccaaaacaatgctcagatga

DBGET integrated database retrieval system