KEGG   Taeniopygia guttata (zebra finch): 100217611Help
Entry
100217611         CDS       T01082                                 

Gene name
PNPLA7
Definition
patatin-like phospholipase domain containing 7
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tgu00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 1317 aa AA seqDB search
MGLAAVPEGGTPILQFVEDRIQTTMLTGIAIGAAVALLLIAVIVFVVYRRVRQSKQLQPH
VPQYRFRKRDKVMFYGRKIMRKVTTLPNSLVGNTVPRQRMRKRAKVLSLAKRILRIKKEC
PTLQRKEPPPSLLEADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFLELCKHMFFVQ
LHEGEYIFRPGQLDNSIYVVQDGKLEVCIQENDGTEVVVKEVLAGDSVHSLLSILDVITG
HPAPYKTVSARAATPSTILRLPASAFQDVFQKYPETLVRVVQIIMVRLQRVTFLALHNYL
GLTTELFSCQSQGTPLISVSSVTAGGSAGKAGKRPTPNALEEDRGEKFEKSGEALEMDML
RISGTENSEHVFRRSLSSPPYAGSTEASNNASGAKSDMDMAYERARVQLVPEDAAGSPAV
AKSILKKTVTVTETPSAVFHYSAVQDSCNSKHVDAIVEAAKKDLSALMKLDNPALLNGKV
TLHQVTAGTVLSRQGDQDVNVCFVVSGMLHVYQRKIDSEEDTCLFITHPGELVGQLAVLT
GEPLIFTIKANRDCSFLSISKSHFYEIMREQPSVVLGVAHTVVKRMSPFVRQIDFALDWM
EVEAGRAVYRQGDKSDCTYIVLNGRLRSVLRMDDGKKHLTGEYGRGDLIGVVEALTHQPR
ATTVHAVRDSELAKLPEGALISIKRKFPQVVTRLIHLLGEKILGSLQQGGHPLGLHSSSS
KWDAGNPASNLSTVAIMPVSEEVPLTAFTLELKHALSAVGPALLLTSDNIKQRLGSAALD
SIHEYRLTSWLGQQEDIHRIVLYQADSTLTPWTQRCIRQADCILIVGLGDQEPSVGELER
MLENTAVRAQKQLILLHKEDGPLPSRTVEWLNMRSWCSAHLHIHCPRRVFSKRSLPKLVE
MYERVFQKAPDRHSDFSRLARVLTGNAIALVLGGGGARGCSQVGVIRALIEAGIPVDMIG
GTSIGAFMSALYAEERSYNQMRIKARQWAMVMNSVFKTILDLTYPITSMFSGAAFNNSIN
NIFKDKQIEDLWIPYFTITTDITASAMRVHRDGSLWRYVRASMSLSGYMPPLCDPKDGHL
LMDGGYINNLPADVARSMGAKVVIAIDVGSRDETDLTNYGDCLSGWWLLWKRWNPLAEKV
KVLNMAEIQTRLAYVCCVRQLEMVKNSDYCEYIRPPIDRYGTLDFGKFDEICEVGYQHGK
TVFNVWCRSGVLDKMLKDRQETCKSKTDNVTCPTTSFTDLAEIVSRIEPVKAPLADDESD
YQTEYEEEVLDSQKDDYLDFISNQAEEDSDSDEEMHLRRRRNVPGGEGQASSTGEPG
NT seq 3954 nt NT seq  +upstreamnt  +downstreamnt
atgggtttggcggctgtgccagaaggtgggacccccatcctgcagtttgtggaggacagg
atccagaccaccatgctgactggaattgcaattggagctgcagttgcactgttgcttata
gcagttattgtgtttgtcgtgtacagaagagtgagacaatctaaacaacttcagccacac
gtgcctcagtacaggtttcgcaagagggacaaagtgatgttctacgggaggaagatcatg
aggaaggttacaactcttcccaactctctggttgggaacaccgtccctcgccagaggatg
cggaaacgggcaaaggttttatctctggctaaaaggattctgcgtattaagaaggaatgt
ccaactctgcagaggaaagaacctcctccttctttgctagaggcagatctgactgaattt
gatgttaagaattcccacttgccatcagaagtcctgtacatgcttaaaaatgtcagggtc
cttgggcactttgagaagcccctgttcctggagctgtgcaagcacatgttctttgtgcag
ctgcacgagggcgagtacatcttccgtcccgggcagctggacaacagcatctacgtggtg
caggatggaaagctggaagtttgcatccaagaaaatgatggaacagaggtggtggtgaag
gaggtgctggcaggagacagcgtgcacagcctgctgagcatcctggatgtcatcacgggt
caccctgctccctataaaacggtctcagcccgagcagccactccatccacaatactgagg
cttccagccagtgccttccaggatgtgttccagaaataccctgaaacccttgtgagagtg
gtgcagatcatcatggtgaggctgcagagggtgacattcctggccttgcacaactacctg
gggctgaccacagagctcttcagctgtcagagccagggcacccctctgatctccgtgagc
agtgtcaccgctggcggcagcgccggcaaggcgggcaagagaccaacgcccaatgctttg
gaggaggatcgtggagagaagtttgaaaagtctggggaagccctggaaatggatatgttg
agaatttctggtacagaaaactctgagcatgttttcagaagaagcctttcatcacctccc
tatgcaggctctacagaggcttctaacaacgccagcggagccaagtccgacatggacatg
gcctacgagagggcgcgggtgcagctggtccccgaggacgccgccggcagccccgccgtg
gccaagtcgatattgaagaagactgtgacagtgacagaaactccttcagcagttttccat
tacagtgctgtgcaggactcctgtaacagcaaacacgttgatgccattgtggaagcagca
aagaaagacctctcagccctgatgaaacttgataatcctgcattgctgaatggcaaagtg
acactgcatcaggtcactgctggcactgtgctgtccaggcagggagatcaggatgtcaat
gtttgctttgtggtctcggggatgctccatgtgtaccagaggaagattgactctgaggag
gacacctgcctcttcatcacccaccccggggagctcgtgggccagctcgctgtcctcact
ggggagcccctgatcttcaccatcaaggccaacagagactgcagcttcctctccatctcc
aagtcccatttctatgagattatgcgggagcagcccagtgtggtgctgggggtggcccac
actgttgtgaagagaatgtccccctttgtcaggcaaattgacttcgccctggactggatg
gaggtcgaggctggacgagctgtttacaggcagggggacaagtctgactgcacgtacatc
gtgctgaacggccgcctgcgctccgtgctgcgcatggacgacggcaagaagcacctgacc
ggggagtacggccggggggacctcatcggagtggtggaagccctgacccaccagcccaga
gccaccacggtgcacgcggtgcgggactcggagctcgccaagctcccggagggggccctg
atctccatcaaacgcaaattcccccaggttgtgaccagacttattcacttgctgggtgag
aagattcttggcagtctgcagcagggaggtcatcctcttggactgcacagctccagcagc
aagtgggatgcagggaatcctgccagcaacctctccacggtggccatcatgccggtgtcc
gaggaggtgccgctgacagccttcaccctggagctcaagcacgccctcagtgctgtgggt
cctgccctgctgctcaccagtgacaacatcaaacagcgcctgggctctgctgctctcgac
agcatccacgagtacagactgaccagctggctgggccagcaggaggacatccacaggatt
gtgctgtaccaggctgacagcaccctgaccccctggacccagcgctgcatccgccaggcc
gactgcatcctcatcgtggggctgggagaccaggagccctctgtgggagagctggagagg
atgctggagaacacggcagtgagagcccagaagcagctgatcctgctccacaaggaggat
gggcccctcccgtcccgcacggtggagtggctcaacatgaggagctggtgttctgctcac
ctccacatccactgcccacgcagagtcttctccaaaaggagtctgcccaagctggtggag
atgtatgaacgtgtgttccagaaggctccagaccgccactccgacttctcccgcctggcc
cgggtcctgacgggcaacgccatcgcgctggtgctgggcggcggcggggccaggggctgc
tcccaggtgggcgttatccgggcgctgatcgaggctggaattcccgtggacatgatcggg
ggcacgtccatcggcgccttcatgagcgccctgtacgccgaggagcgcagctacaaccag
atgaggatcaaagctcgccagtgggccatggttatgaactcggtgtttaagactattcta
gacttgacatacccaataacctctatgttttctggagcagcttttaacaacagcatcaac
aacatcttcaaagataaacagatagaggatctgtggattccttacttcaccatcaccact
gacatcactgcctcggccatgagggtgcacagggatggctccctgtggaggtacgtccgg
gccagcatgtccctctcggggtacatgcctcccctctgtgaccccaaggatggccatctc
ctcatggatgggggctacatcaacaacctgccagctgacgtggccaggtccatgggggcc
aaggtggtgatcgccatcgacgtgggcagccgcgacgagaccgacctgaccaactacggc
gactgcctgtccggctggtggctgctctggaagaggtggaaccccctggctgagaaagtc
aaggtgctgaacatggctgagatccagaccaggctggcctatgtgtgctgcgtgcggcag
ctggagatggtgaagaacagcgactactgcgagtacatccggccccccatcgaccgctac
ggcaccctggacttcggcaagttcgacgagatctgtgaagtgggataccagcatgggaaa
actgtatttaatgtgtggtgcaggagtggagtccttgacaagatgctgaaggacaggcaa
gagacctgcaaatccaaaactgataacgtgacctgtcccaccacgtccttcacagacctg
gccgagatcgtgtcccgcatcgagcccgtcaaggctccgctggcagacgatgagtcagac
taccagactgagtatgaggaagaagttctggacagccagaaggatgattacctcgatttc
ataagcaaccaggctgaggaagactctgactcggatgaggagatgcacctgaggaggcgc
aggaatgtgcctggtggggagggccaggcgagcagcaccggagagccgggatag

DBGET integrated database retrieval system