KEGG   Taeniopygia guttata (zebra finch): 100217632Help
Entry
100217632         CDS       T01082                                 

Gene name
THBS3
Definition
(RefSeq) thrombospondin 3
  KO
K04659  
thrombospondin 2/3/4/5
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100217632 (THBS3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100217632 (THBS3)
  Cellular commiunity
   04510 Focal adhesion
    100217632 (THBS3)
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100217632 (THBS3)
  Exosomal proteins of colorectal cancer cells
   100217632 (THBS3)
  Exosomal proteins of bladder cancer cells
   100217632 (THBS3)
Glycosaminoglycan binding proteins [BR:tgu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100217632 (THBS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1127 aa AA seqDB search
PVRVPHLSASPRTAHLHTAQSRLAPHIPARPHIASHGSAPSCSHFSVPHRAHSAPHLPAW
AHPARPRTPRTLHEQQPGRDPAGSGGRKPPRVRLHRYAGPLARSRTGGAGLGQPRGRARP
VVMAPGETAVNTAGTPPWPELRGSGSAARASPAGTERPRSSAGPWGTSEQRPVPLYRAGI
FRRCWGDPSNPPPPTPPDLPVNRRCERGLSRGIPEALGSARRTGSVPGSEAGPEIGNPPV
SQGFIDLLLVSEARQMASVAHKIRMELLTVNDVYLLSTFRLPPKQGGTLFGLYSKKDNTR
WLEVSVVGKINKVLVRYLREDNKVHSVNLQHAQVADGQSHSVIVRLSGLRRDTLSVELYV
DCKQMDSSVGLPELSEIPLAEVESIEVRTGLKAYQRMQGFVESMKLILGGSMSRVGALSE
CPFQGDESIHGAVTSVLASILGEQTKALVTQLTLFNQVLTDLREDIRDQVKEMSLIRNTI
MECQVCGFHEHRSRCNPNPCFSGVDCMETYEYPGYRCGPCPPGLEGNGTHCADIEECAHA
NPCFPGSKCINTSPGFRCEPCPRGYRGNTVSGVGVDYAKASKQVCTDIDECNDGNNGGCD
PNSICTNTLGSYKCGPCKSGFVGNQTSGCVPQRSCSTATSNPCDINGFCLFERNGEISCA
CNVGWAGNGNVCGPDTDLDGYPDEPLPCIDNNKHCKQDNCRLTPNSGQEDADNDGIGDQC
DDDADGDGVKNVEDNCRLFPNKDQQNSDTDSFGDACDNCPNVPNNDQRDTDSNGEGDACD
NDIDGDGIPNMLDNCPKVPNPLQTDRDEDGVGDACDSCPEMSNPTQTDMDSDLVGDICDT
NEDSDGDGHQDTKDNCAEIPNSSQLDSDNDGLGDDCDNDDDNDGIPDYVAPGPDNCRLIP
NPNQKDSDGNGVGDVCEEDFDNDTVVDQLDVCPESAEVTLTDFRAYQTVILDPEGDAQID
PNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTITDDDYAGFIFSYQDSAS
FYVVMWKQTEQTYWQATPFRAVAEPGLQLKAVKSSTGPGEHLRNALWHTGHTPDHVRLLW
KDPRNVGWRDKTSYRWQLAHRPQVGYIRTTSGVEDVHEEALCLPGPP
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
cccgtccgtgtcccgcatctctctgcatctccccgcaccgctcacctccacaccgcccag
tcccgcttagccccgcacatccccgcacggccccacatcgcctcgcacggctcagctcca
tcctgctcacacttctcggtcccgcaccgggctcacagtgccccgcatctccccgcgtgg
gcccaccctgctcggccccgcaccccccgcactctccacgaacagcagccgggccgggat
cccgctggcagcggcgggaggaaaccgccccgtgtgcggctccatcgttacgcgggaccg
ctggcgcggagccgcaccgggggcgcggggctggggcagccccggggccgggctcggccc
gttgttatggcaccgggggaaacagctgtaaacacggccgggacgccgccttggccggag
ctccgcgggagcggctcggcggcccgagcatcccccgccggtacggagcggccccggagc
tctgccggtccgtggggcacctctgaacagcggccggttccgctttaccgggccgggatt
ttccggcgctgttggggcgaccccagcaacccccctccccccaccccgcctgacctcccg
gtgaaccggcgctgtgaacgggggctgtcccggggcatccccgaagccctgggctcagcg
cgccgcaccggctcggtgcccggctctgaggccggacccgagatcggaaacccaccggtg
tcccagggatttattgacctgctgctggtgagcgaggctcggcagatggccagcgtggcc
cacaagatccgcatggagcttctgactgtcaacgacgtgtacctcctgtccaccttccgc
ctgccccccaagcagggcgggaccctcttcggcctctactccaagaaggacaacacccgg
tggctggaggtgtctgtcgtggggaagattaacaaagtcctggtgaggtacctgcgggag
gacaacaaggtgcactcggtcaacctgcagcacgcgcaggtggcggacgggcagagccac
tctgtcatcgtgcgcctgagcgggctgcgaagggacacgctgagcgtggagctctacgtg
gactgcaagcagatggactccagcgtggggctgcccgagctctccgagatccccctggcc
gaggtggagtccatcgaggtgcgcacggggctgaaggcctaccagaggatgcaggggttt
gtggagtccatgaagctgatcctgggagggtccatgagccgtgtaggggccctgagtgag
tgccctttccaaggagatgagtccattcacggtgcagtgacgagcgtgctggcctccatc
ctgggtgagcagaccaaggcactggtcacacagctgaccctcttcaaccaggtcctgacc
gacttacgggaagacattagggaccaggtgaaggagatgtctctgatccgcaacaccatc
atggagtgccaggtctgcggtttccacgagcaccgctcccgctgcaaccccaatccctgc
ttcagcggtgtggactgcatggagacctacgagtaccccgggtaccgctgtgggccctgc
ccgccggggctggagggcaacggcacacactgcgctgacattgaggagtgtgcccatgcc
aacccctgtttccccggctccaagtgcatcaacacgtcccccgggttccgctgcgagccc
tgcccccgtggctatcgaggcaacactgtctctggcgtgggggtggactatgccaaggcc
agcaagcaggtttgcacagatatcgatgaatgcaacgatgggaacaatgggggctgcgac
cccaactccatctgcaccaacacgctgggttcctacaagtgtgggccctgcaagtcgggc
tttgtgggcaaccaaacgtccggctgcgtcccgcagaggtcctgcagcactgccacctcc
aacccctgcgacatcaacggcttctgcctgtttgagaggaacggcgagatctcctgcgca
tgcaacgtgggctgggctggcaatggcaatgtgtgtgggccagacacggacctggatggg
tacccggacgagcccctgccctgcatcgacaacaacaagcactgcaagcaggacaactgc
cgcctgacgcccaattccgggcaggaggacgctgacaacgacggcattggggaccaatgt
gatgacgacgctgatggtgatggtgtcaagaatgtggaggacaactgccggctcttcccc
aacaaggaccaacagaactcggacactgactccttcggggacgcctgtgacaactgcccc
aacgttcccaacaatgaccagcgggacacggacagcaacggcgagggggacgcttgtgac
aatgacatcgatggggacgggatacccaacatgctggataactgccccaaggtgcccaac
cctctgcagactgatcgggacgaggacggtgttggggatgcctgtgacagttgccctgaa
atgagcaaccccactcagacagatatggacagtgacctggtaggagacatctgtgacacc
aacgaggacagcgatggggatgggcatcaggacaccaaggacaactgcgctgagatcccc
aacagctcccagctggactcggacaacgacgggctgggggatgactgtgacaacgacgat
gacaacgatggcatcccggattatgtggcgcctggcccagacaactgccgcctcatcccc
aatcccaaccagaaagactcagacgggaatggcgtgggtgacgtctgcgaggaggacttc
gacaacgacacggtggtggaccagctggacgtgtgccccgagagcgccgaggtgacgctg
accgacttccgcgcctaccaaaccgtcatcctggaccccgagggggacgcccagatcgac
cccaactgggtggtgctgaaccagggcatggagatcgtgcagaccatgaacagtgacccg
ggtttggctgtgggttacacagccttcaacggggtagactttgagggcaccttccacgtc
aacaccatcaccgacgatgactacgccggcttcatcttcagctaccaggacagcgccagc
ttctacgtggtgatgtggaagcagacggagcagacatactggcaagccactcccttccgt
gctgtggccgagccagggctgcagctcaaggcagtgaaatcctcgacgggccccggggag
cacctgcgcaatgcgctgtggcacacgggccacacgcccgaccacgtccgcctgctctgg
aaggaccccaggaacgtgggctggagggacaagacgtcctaccgctggcagctggcacac
aggccccaggtgggctacatcagaaccacctcaggggtagaggatgtccatgaggaggcc
ttgtgcctcccgggaccaccctag

DBGET integrated database retrieval system