KEGG   Taeniopygia guttata (zebra finch): 100217632Help
Entry
100217632         CDS       T01082                                 

Definition
thrombospondin-3-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100217632
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100217632
  Cellular commiunity
   04510 Focal adhesion
    100217632
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100217632
  Exosomal proteins of colorectal cancer cells
   100217632
  Exosomal proteins of bladder cancer cells
   100217632
Heparan sulfate/heparin binding proteins [BR:tgu00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100217632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1127 aa AA seqDB search
PVRVPHLSASPRTAHLHTAQSRLAPHIPARPHIASHGSAPSCSHFSVPHRAHSAPHLPAW
AHPARPRTPRTLHEQQPGRDPAGSGGRKPPRVRLHRYAGPLARSRTGGAGLGQPRGRARP
VVMAPGETAVNTAGTPPWPELRGSGSAARASPAGTERPRSSAGPWGTSEQRPVPLYRAGI
FRRCWGDPSNPPPPTPPDLPVNRRCERGLSRGIPEALGSARRTGSVPGSEAGPEIGNPPV
SQGFIDLLLVSEARQMASVAHKIRMELLTVNDVYLLSTFRLPPKQGGTLFGLYSKKDNTR
WLEVSVVGKINKVLVRYLREDNKVHSVNLQHAQVADGQSHSVIVRLSGLRRDTLSVELYV
DCKQMDSSVGLPELSEIPLAEVESIEVRTGLKAYQRMQGFVESMKLILGGSMSRVGALSE
CPFQGDESIHGAVTSVLASILGEQTKALVTQLTLFNQVLTDLREDIRDQVKEMSLIRNTI
MECQVCGFHEHRSRCNPNPCFSGVDCMETYEYPGYRCGPCPPGLEGNGTHCADIEECAHA
NPCFPGSKCINTSPGFRCEPCPRGYRGNTVSGVGVDYAKASKQVCTDIDECNDGNNGGCD
PNSICTNTLGSYKCGPCKSGFVGNQTSGCVPQRSCSTATSNPCDINGFCLFERNGEISCA
CNVGWAGNGNVCGPDTDLDGYPDEPLPCIDNNKHCKQDNCRLTPNSGQEDADNDGIGDQC
DDDADGDGVKNVEDNCRLFPNKDQQNSDTDSFGDACDNCPNVPNNDQRDTDSNGEGDACD
NDIDGDGIPNMLDNCPKVPNPLQTDRDEDGVGDACDSCPEMSNPTQTDMDSDLVGDICDT
NEDSDGDGHQDTKDNCAEIPNSSQLDSDNDGLGDDCDNDDDNDGIPDYVAPGPDNCRLIP
NPNQKDSDGNGVGDVCEEDFDNDTVVDQLDVCPESAEVTLTDFRAYQTVILDPEGDAQID
PNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTITDDDYAGFIFSYQDSAS
FYVVMWKQTEQTYWQATPFRAVAEPGLQLKAVKSSTGPGEHLRNALWHTGHTPDHVRLLW
KDPRNVGWRDKTSYRWQLAHRPQVGYIRTTSGVEDVHEEALCLPGPP
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
cccgtccgtgtcccgcatctctctgcatctccccgcaccgctcacctccacaccgcccag
tcccgcttagccccgcacatccccgcacggccccacatcgcctcgcacggctcagctcca
tcctgctcacacttctcggtcccgcaccgggctcacagtgccccgcatctccccgcgtgg
gcccaccctgctcggccccgcaccccccgcactctccacgaacagcagccgggccgggat
cccgctggcagcggcgggaggaaaccgccccgtgtgcggctccatcgttacgcgggaccg
ctggcgcggagccgcaccgggggcgcggggctggggcagccccggggccgggctcggccc
gttgttatggcaccgggggaaacagctgtaaacacggccgggacgccgccttggccggag
ctccgcgggagcggctcggcggcccgagcatcccccgccggtacggagcggccccggagc
tctgccggtccgtggggcacctctgaacagcggccggttccgctttaccgggccgggatt
ttccggcgctgttggggcgaccccagcaacccccctccccccaccccgcctgacctcccg
gtgaaccggcgctgtgaacgggggctgtcccggggcatccccgaagccctgggctcagcg
cgccgcaccggctcggtgcccggctctgaggccggacccgagatcggaaacccaccggtg
tcccagggatttattgacctgctgctggtgagcgaggctcggcagatggccagcgtggcc
cacaagatccgcatggagcttctgactgtcaacgacgtgtacctcctgtccaccttccgc
ctgccccccaagcagggcgggaccctcttcggcctctactccaagaaggacaacacccgg
tggctggaggtgtctgtcgtggggaagattaacaaagtcctggtgaggtacctgcgggag
gacaacaaggtgcactcggtcaacctgcagcacgcgcaggtggcggacgggcagagccac
tctgtcatcgtgcgcctgagcgggctgcgaagggacacgctgagcgtggagctctacgtg
gactgcaagcagatggactccagcgtggggctgcccgagctctccgagatccccctggcc
gaggtggagtccatcgaggtgcgcacggggctgaaggcctaccagaggatgcaggggttt
gtggagtccatgaagctgatcctgggagggtccatgagccgtgtaggggccctgagtgag
tgccctttccaaggagatgagtccattcacggtgcagtgacgagcgtgctggcctccatc
ctgggtgagcagaccaaggcactggtcacacagctgaccctcttcaaccaggtcctgacc
gacttacgggaagacattagggaccaggtgaaggagatgtctctgatccgcaacaccatc
atggagtgccaggtctgcggtttccacgagcaccgctcccgctgcaaccccaatccctgc
ttcagcggtgtggactgcatggagacctacgagtaccccgggtaccgctgtgggccctgc
ccgccggggctggagggcaacggcacacactgcgctgacattgaggagtgtgcccatgcc
aacccctgtttccccggctccaagtgcatcaacacgtcccccgggttccgctgcgagccc
tgcccccgtggctatcgaggcaacactgtctctggcgtgggggtggactatgccaaggcc
agcaagcaggtttgcacagatatcgatgaatgcaacgatgggaacaatgggggctgcgac
cccaactccatctgcaccaacacgctgggttcctacaagtgtgggccctgcaagtcgggc
tttgtgggcaaccaaacgtccggctgcgtcccgcagaggtcctgcagcactgccacctcc
aacccctgcgacatcaacggcttctgcctgtttgagaggaacggcgagatctcctgcgca
tgcaacgtgggctgggctggcaatggcaatgtgtgtgggccagacacggacctggatggg
tacccggacgagcccctgccctgcatcgacaacaacaagcactgcaagcaggacaactgc
cgcctgacgcccaattccgggcaggaggacgctgacaacgacggcattggggaccaatgt
gatgacgacgctgatggtgatggtgtcaagaatgtggaggacaactgccggctcttcccc
aacaaggaccaacagaactcggacactgactccttcggggacgcctgtgacaactgcccc
aacgttcccaacaatgaccagcgggacacggacagcaacggcgagggggacgcttgtgac
aatgacatcgatggggacgggatacccaacatgctggataactgccccaaggtgcccaac
cctctgcagactgatcgggacgaggacggtgttggggatgcctgtgacagttgccctgaa
atgagcaaccccactcagacagatatggacagtgacctggtaggagacatctgtgacacc
aacgaggacagcgatggggatgggcatcaggacaccaaggacaactgcgctgagatcccc
aacagctcccagctggactcggacaacgacgggctgggggatgactgtgacaacgacgat
gacaacgatggcatcccggattatgtggcgcctggcccagacaactgccgcctcatcccc
aatcccaaccagaaagactcagacgggaatggcgtgggtgacgtctgcgaggaggacttc
gacaacgacacggtggtggaccagctggacgtgtgccccgagagcgccgaggtgacgctg
accgacttccgcgcctaccaaaccgtcatcctggaccccgagggggacgcccagatcgac
cccaactgggtggtgctgaaccagggcatggagatcgtgcagaccatgaacagtgacccg
ggtttggctgtgggttacacagccttcaacggggtagactttgagggcaccttccacgtc
aacaccatcaccgacgatgactacgccggcttcatcttcagctaccaggacagcgccagc
ttctacgtggtgatgtggaagcagacggagcagacatactggcaagccactcccttccgt
gctgtggccgagccagggctgcagctcaaggcagtgaaatcctcgacgggccccggggag
cacctgcgcaatgcgctgtggcacacgggccacacgcccgaccacgtccgcctgctctgg
aaggaccccaggaacgtgggctggagggacaagacgtcctaccgctggcagctggcacac
aggccccaggtgggctacatcagaaccacctcaggggtagaggatgtccatgaggaggcc
ttgtgcctcccgggaccaccctag

DBGET integrated database retrieval system