KEGG   Taeniopygia guttata (zebra finch): 100217987Help
Entry
100217987         CDS       T01082                                 

Definition
(RefSeq) cytochrome P450 2J2
  KO
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100217987
   00591 Linoleic acid metabolism
    100217987
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100217987
Cytochrome P450 [BR:tgu00199]
 Cytochrome P450, animal type
  CYP2 family
   100217987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
8
AA seq 496 aa AA seqDB search
MELQFWPDLVSVLKKMNSWMVLVVLVILFLIIDLVRKRRPRNFPPGPQLFPLVGTVVDFK
QPLHLALQKLTGQYGNIFSVQFGSLTFVVVSGYQMVREALVHQAETFADRPNIPLLQEIF
RGFGLISSNGHIWRQQRKFASATLKSLAVNFEEKVQEESRYLVETIEEEKGQPFDPHYKI
NSAVSNIICSITFGNRFDYHDNRFQELLHSLAETLLLIGSFWGQLYNAFPLIMRWLPGPF
RKIFRHWEKLQYFVKEVIAKHKEDLDQSKAGDYIDCYLKEIEKFKGDTSSYFHEENLLCC
TLDLFLTGTETTATAIRWALLYMAAYPHIQEKVQQEIDAVVGQCRQPSMADKEKMPYTSA
VLSEVLRVGNMVPLGVPRMATSDTTLAGFHLPKGTTLMTSLTSVMFDKNVWETPDTFNPE
HFLENGLYRRREAFLPFSAGKRACPGEQLARTELFIFFVALLQKFTFQAPAALSFAFTLS
LTRCPKPFQLCAVPRH
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggagctacagttttggcctgatttggtgtctgtcttgaaaaagatgaacagttggatg
gtcctggtggttctggtcatattgtttttaattattgacctagtgagaaagagacgaccc
aggaatttccctccagggccgcagctctttcctctcgtgggaaccgttgtggactttaag
cagcctctccatcttgcactgcagaagcttacgggtcagtacgggaacatcttcagcgtg
cagtttggaagtctgacattcgtggtggtcagcgggtaccagatggtgagagaagctctt
gtccaccaggctgaaacatttgctgatcggccaaatattccactcctccaagaaatattt
cgaggctttgggctcatatcatccaacgggcacatatggaggcagcagagaaagtttgct
tcagcaacactgaaaagccttgctgtaaactttgaggagaaagtgcaagaggagagtcgg
tacctcgtggagacaattgaggaggagaaaggacaaccctttgaccctcattacaaaatt
aatagtgctgtttccaacatcatctgttccataacttttgggaaccgctttgactaccat
gacaaccgtttccaggaactgctgcactccctggctgaaacgctgctgctcatcggaagt
ttctggggccagctctataatgcttttcctttgatcatgagatggttaccaggacccttc
aggaaaatcttcaggcactgggagaaacttcaatattttgtgaaagaagtgattgcaaag
cacaaggaggatttagaccagtccaaggcaggagattatattgactgttacctgaaggaa
atagaaaagtttaagggtgacaccagctcctatttccatgaggaaaacctgctgtgctgc
accttggacctgttcttaactgggactgagacgacagcgaccgccatccgctgggctctg
ctctacatggccgcgtacccccacattcaggagaaagtgcagcaggagatcgacgccgtg
gttgggcagtgccggcagccctcgatggctgacaaagagaagatgccctacaccagcgcc
gtgctgagcgaggtcctgcgtgtgggcaacatggtgccactgggggtgccccgcatggcc
accagcgacaccaccctggccggctttcacctgcccaaaggcaccaccctgatgaccagc
ctgacttcagtgatgttcgacaaaaacgtgtgggagactccagacacctttaatcctgaa
catttcctggaaaacggcctgtacaggagacgggaggcttttctgcccttctctgcaggc
aagagggcttgtcccggggagcagctcgccaggaccgagctcttcatcttcttcgtggcc
ctgctgcagaagttcaccttccaggccccagcagcgctgtccttcgccttcacgctcagc
ctcacgcgctgccccaaacccttccagctctgcgccgtgccccgccactga

DBGET integrated database retrieval system