KEGG   Taeniopygia guttata (zebra finch): 100217987Help
Entry
100217987         CDS       T01082                                 

Definition
cytochrome P450 2J2-like
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:tgu00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:tgu00591]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 477 aa AA seqDB search
MVLVVLVILFLIIDLVRKRRPRNFPPGPQLFPLVGTVVDFKQPLHLALQKLTGQYGNIFS
VQFGSLTFVVVSGYQMVREALVHQAETFADRPNIPLLQEIFRGFGLISSNGHIWRQQRKF
ASATLKSLAVNFEEKVQEESRYLVETIEEEKGQPFDPHYKINSAVSNIICSITFGNRFDY
HDNRFQELLHSLAETLLLIGSFWGQLYNAFPLIMRWLPGPFRKIFRHWEKLQYFVKEVIA
KHKEDLDQSKAGDYIDCYLKEIEKFKGDTSSYFHEENLLCCTLDLFLTGTETTATAIRWA
LLYMAAYPHIQEKVQQEIDAVVGQCRQPSMADKEKMPYTSAVLSEVLRVGNMVPLGVPRM
ATSDTTLAGFHLPKGTTLMTSLTSVMFDKNVWETPDTFNPEHFLENGLYRRREAFLPFSA
GKRACPGEQLARTELFIFFVALLQKFTFQAPAALSFAFTLSLTRCPKPFQLCAVPRH
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggtcctggtggttctggtcatattgtttttaattattgacctagtgagaaagagacga
cccaggaatttccctccagggccgcagctctttcctctcgtgggaaccgttgtggacttt
aagcagcctctccatcttgcactgcagaagcttacgggtcagtacgggaacatcttcagc
gtgcagtttggaagtctgacattcgtggtggtcagcgggtaccagatggtgagagaagct
cttgtccaccaggctgaaacatttgctgatcggccaaatattccactcctccaagaaata
tttcgaggctttgggctcatatcatccaacgggcacatatggaggcagcagagaaagttt
gcttcagcaacactgaaaagccttgctgtaaactttgaggagaaagtgcaagaggagagt
cggtacctcgtggagacaattgaggaggagaaaggacaaccctttgaccctcattacaaa
attaatagtgctgtttccaacatcatctgttccataacttttgggaaccgctttgactac
catgacaaccgtttccaggaactgctgcactccctggctgaaacgctgctgctcatcgga
agtttctggggccagctctataatgcttttcctttgatcatgagatggttaccaggaccc
ttcaggaaaatcttcaggcactgggagaaacttcaatattttgtgaaagaagtgattgca
aagcacaaggaggatttagaccagtccaaggcaggagattatattgactgttacctgaag
gaaatagaaaagtttaagggtgacaccagctcctatttccatgaggaaaacctgctgtgc
tgcaccttggacctgttcttaactgggactgagacgacagcgaccgccatccgctgggct
ctgctctacatggccgcgtacccccacattcaggagaaagtgcagcaggagatcgacgcc
gtggttgggcagtgccggcagccctcgatggctgacaaagagaagatgccctacaccagc
gccgtgctgagcgaggtcctgcgtgtgggcaacatggtgccactgggggtgccccgcatg
gccaccagcgacaccaccctggccggctttcacctgcccaaaggcaccaccctgatgacc
agcctgacttcagtgatgttcgacaaaaacgtgtgggagactccagacacctttaatcct
gaacatttcctggaaaacggcctgtacaggagacgggaggcttttctgcccttctctgca
ggcaagagggcttgtcccggggagcagctcgccaggaccgagctcttcatcttcttcgtg
gccctgctgcagaagttcaccttccaggccccagcagcgctgtccttcgccttcacgctc
agcctcacgcgctgccccaaacccttccagctctgcgccgtgccccgccactga

DBGET integrated database retrieval system