KEGG   Taeniopygia guttata (zebra finch): 100218275Help
Entry
100218275         CDS       T01082                                 

Gene name
RAD54B
Definition
RAD54 homolog B (S. cerevisiae)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    100218275 (RAD54B)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     100218275 (RAD54B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 919 aa AA seqDB search
MRRSAAPSQVLGNAGKKPRFIPPGKCTAVCPKNETKEMDQEIKSKEIDEKEGGASLLSKI
SIQNQNENFTQSMESTGKIKTKACFSIDKYSKAEKRTLTVPKADALYLPTSGTAKEEAAQ
EAPDCLVKYFSVVWCKASKKKHKKWEGDAILITKGKSVILKDMEGKDIGRGTGYKAKELD
SLDEGQTLMVGGKEIEVMGVISADDFSSGRCFQAGIGTHETDATALSQTNTKPFCKPFKN
VCQPSPKENTLRYSQSCKPRHDPNATNAVVMPRPNASLQWMFNKAGLPVVDVVVDPYIAN
NLRPHQKEGIIFLYECVMGMRVSGRFGAILADEMGLGKTLQCIALVWTLLRQGPYGCKPV
LKRALVVTPGSLVKNWKKEFQKWLGNERIKVFAVDQDHKVEEFISSPLYSVMIISYEMLL
RSSDQIEAVEFNLLICDEGHRLKNSTIKTTTALTSLSCERRIILTGTPIQNDLQEFYALI
EFVNPGILGSLSTYRKIYEEPIVRSREPSATEEEKELGEKRAAELTRLTGLFILRRTQEV
INKFLPPKKESIIFCRPTALQLELYRKLLGSRVITSCLQGRLENSPHLICIGALKKLCNH
PCLLFKAIKEKSCDPMSEEYDESSLYEGVIDVFPQDYTSDTFCETDSGKLQVLVKLLAAI
HELNSSERVVLVSNYTQTLNVLQDVCKHYGYSYTRLDGHTPVSQRQHIVDTFNSKFSPAF
IFLLSSKAGGVGLNLVGASHLILYDIDWNPATDIQAMARVWRDGQKHSVHIYRLLTTGSI
EEKIYQRQISKQDLSGAVVDLSKTSEHTHFSIEELKNLFTLHEDSSCVTHDLLECDCMGK
VDHQNTSSEKPPLSRSCQLEQNHGKPNSKKPLSMSQLMQWKHFSGQHQPLADPFLERIKE
NVSFIFQNVTSPTSPPNKT
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgatctgcagctcccagtcaagtcctaggaaatgctggcaaaaagccaaggttt
ataccaccaggaaaatgtactgctgtttgtcccaagaatgaaactaaggagatggaccaa
gaaattaagtcgaaggagatagatgagaaagagggaggtgcttcattgctatctaaaata
agtatccagaatcaaaatgaaaattttacacagtctatggagtcaactggaaaaataaag
acaaaagcatgtttcagcattgacaagtatagcaaggcagaaaagagaacactaactgtg
cccaaagctgatgcactgtatttgccaacatcagggactgcaaaggaagaagcagctcag
gaagcacctgactgccttgtgaaatatttcagtgtcgtgtggtgtaaggcatcaaagaaa
aagcacaagaagtgggaaggcgatgctattcttattacaaaaggaaagtcagtaatattg
aaagatatggaaggcaaagacattggcagaggtactggatataaagctaaagagctagac
agccttgatgaaggtcaaacactgatggttggcggaaaagaaattgaagtgatgggtgta
atttcagcagatgatttcagcagtggcaggtgttttcaggctggaataggaactcatgaa
acagatgcaactgcattatctcaaactaatacaaaaccattctgtaaaccattcaaaaat
gtctgtcaacctagtcctaaagagaatacactcagatattctcaaagctgcaaacctcgc
catgatccaaatgctacaaatgctgtggttatgccccggccaaatgcaagtcttcagtgg
atgttcaataaggctggtttacccgtggtggatgtagttgtagatccttacattgcaaat
aatctccgcccacatcagaaagaaggaattatatttctatatgaatgtgtaatgggaatg
agagtcagtggcaggtttggagctattctggctgatgagatgggcttaggaaaaaccctg
cagtgcattgcacttgtctggactcttctgcgtcaagggccctacggatgcaaacctgta
ctaaagcgagcactggtcgtcacccctgggagtctggtgaaaaactggaaaaaagaattt
cagaaatggctgggaaatgaaaggatcaaagtctttgcagttgatcaggaccacaaagta
gaagaattcatcagttctccactttattctgtaatgataatcagttatgagatgctgttg
cgatcttcagatcaaattgaggctgtagaatttaacctcctaatctgtgatgaaggacat
cgtctgaaaaatagcactattaagacaactacagcccttacgagtctgtcttgtgagagg
agaattatcctcactggtactccaatccaaaatgacttgcaagaattttatgcattaata
gagtttgtgaatccaggaatacttggttctttatccacgtacagaaagatatatgaggaa
ccaattgtcagatctagagaaccttcagcaacagaggaggaaaaggaattaggagaaaaa
agagcagctgaactcactcgcctcactggactctttattctaagaagaacacaggaggtt
ataaacaaatttctgccccccaaaaaggagagcataattttctgccgaccaacagcactg
caacttgaattgtatcgcaaactgcttggttctcgtgttattacatcgtgtctgcaaggc
aggctggaaaatagtccccacctaatatgtataggggctctgaaaaaactttgcaatcat
ccatgccttctgtttaaagctataaaggaaaaaagttgtgatcctatgtctgaggaatat
gatgagtccagcctctatgaaggtgtaatagatgtcttcccacaagattatacttcagac
actttctgtgaaactgattcaggaaaattgcaggtgctggtgaagttgctggcagcaatc
catgagctcaactcttctgaaagagtcgtgttggtatcaaattacactcagacgttaaat
gtattacaagatgtatgcaaacattatggatactcctatactagacttgatggacatact
cctgtctcccagagacaacatattgtggatactttcaatagtaaattcagcccagctttt
atctttttgctgagttcaaaggctggtggagtgggactgaacctggttggagcatctcat
ttgatcctgtatgatatcgactggaatccagctacagatattcaggcaatggctagagtg
tggagagatggtcagaaacattctgtccatatctacaggctgctaaccacaggttcaata
gaagaaaagatttaccaaagacagatcagcaaacaagacctttctggggcagttgtagac
ctttccaagacatctgaacacacacatttttctattgaggagcttaaaaatctctttact
ctacatgaagattccagctgtgttactcatgacttgcttgagtgcgactgtatgggaaag
gttgaccatcaaaatacttcttcagaaaagcctcccttatctagaagctgccagcttgaa
caaaaccatgggaagcctaattcaaagaaaccactttccatgtcacagttgatgcaatgg
aagcatttctctgggcaacatcagcctcttgctgatcctttccttgaaaggataaaagaa
aatgtttctttcattttccagaatgtaaccagtcctacttccccacctaataaaacctga

  All links  
No link information was found.   
DBGET integrated database retrieval system