KEGG   Taeniopygia guttata (zebra finch): 100218289Help
Entry
100218289         CDS       T01082                                 

Gene name
PTPN7
Definition
protein tyrosine phosphatase, non-receptor type 7
Orthology
K18019  
tyrosine-protein phosphatase non-receptor type 7 [EC:3.1.3.48]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tgu04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
26
AA seq 339 aa AA seqDB search
MDKQDKPSPSAKKHVRLQERRGSNVSLVLDMSSLGNVEPIQPVCTPRDITLQFLRTSSHV
LRKQELQQHAQSLAQLQEEFSKIPPNFVSPEELEIPGRAFKDRYKTILPNPESRVCLRRA
GSQEEDSYINANYITGYAGRPREYIATQGPLLSTVSDFWQMVWQEEAPLIVMITELQERK
EKCVHYWPEKEGTYGPFTIQVQGVSESVEYVVRDLSIQVESESRKVKHILFPSWPDQQTP
ESAKPLLHLVSKVEEALQTAASPGPIVVHCSAGIGRTGCFIATRIGCQQLQDKGEVDILG
IVCHLRIDRGGMIQTSEQYQFLHHTLALFASQLPEGAGR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggacaagcaggacaagcccagtccctctgccaagaagcacgtgcgactccaggagagg
aggggctccaacgtgtcactggtgctggatatgagctctctagggaacgtggagcccatc
cagcctgtctgcacgccacgggacatcacgctgcagtttctgaggacgtccagccacgtg
ctgaggaaacaggagctgcagcagcacgcccagagcctggcacagctccaggaggagttt
tcgaaaatcccacccaacttcgtgagtccggaggagctggaaatccctggacgtgctttc
aaggacagatacaaaaccattctccccaatcctgagagccgggtctgcctcaggagggct
ggaagccaggaggaagacagctacataaatgccaactacatcacaggctacgcggggcgg
ccccgggagtacatcgccacgcagggaccgctgctgagcaccgtgagtgacttctggcag
atggtgtggcaggaggaggctcctctcatcgtcatgatcaccgagctccaggagcgcaag
gagaaatgtgtccactactggcccgagaaggagggcacctatggccccttcaccatccag
gtgcagggggtgagcgagtctgtggagtacgtggtgcgggacctctccatccaggtggaa
agtgaaagccgcaaggtcaaacacatcctcttcccttcctggccggaccagcagacaccc
gagtcagccaagcccctgctgcacctggtgtccaaggtggaggaggctctgcagactgca
gccagcccggggcccatcgtggtgcactgcagcgcgggcatcggccgcaccggctgcttc
attgccaccaggatcgggtgccagcagctgcaggacaagggggaggtggatatccttgga
atcgtgtgccatctgcgcatagacagaggtgggatgatccagacgagcgagcagtaccag
ttcctccatcacacgctagctctcttcgcttcccagctgccagagggggcaggccgctag

DBGET integrated database retrieval system