KEGG   Taeniopygia guttata (zebra finch): 100218324Help
Entry
100218324         CDS       T01082                                 

Gene name
USP1
Definition
ubiquitin specific peptidase 1
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Fanconi anemia pathway
Class
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:tgu03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 784 aa AA seqDB search
MPGVLPGDSARASPSKKNRLSLKLFQKKEAKRVLDFVEAQENEAKGAELRGAEIDQVVPA
AQPPSLVSCEKKDNMLPFVGLNNLGNTCYLNSVLQVLYFCPGFKTGVKHLYNIISKKRES
SKDEGEQKAEKGSCKEDPLASYELICSLHSLILSVEQLQASFLLNPEKYTDELATQPRRL
LNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEELNKLPVEEPAAKLEEKPNQ
NSESNGSVSPAEAEDPTPGSHGGDAAKEKLLKANGKRKSDAEGGNAKKKSKVSKEQIAAE
ENQRQTRSKRKATGEKMENQTDAIAKCSGDSESAKPTQKKSRLRLNWLKSSCRQPSILSK
FYSLGKLTTNLGSKEPGKEYDCEFEESAVKCENGDSKEEYREPASPLESHHGKGTEKEPK
KEGTELAVFELVEKLFQGQLVLRTRCLECECFTERREDFQDISVPVQEDELSKSEESSEI
SPEPKTEMKTLKWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKC
FAASGLEFDCYGGLSKINTPLLTPLRLSLEEWSTRPTNDTYGLFAVVMHSGITISSGHYT
ASVKVTDLQSLELDRGNFLPEPGYAALKPEPLTEEEARAVAEDYDDGEVSFRPSGAAPPG
KVLSKKNMEAVGLLGGQKSKADCELCASKQPNPEKLLSVAPEPRSEPSAEPRAEQGEPTA
LGANGLENKALYVLQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPTSSSTSTPYLLFYK
KIVE
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcgtcctgcccggcgacagcgccagggccagcccctccaagaagaaccggctg
tcgctgaagctgtttcagaagaaggaggcgaagcgggtgctggatttcgtggaggcgcag
gaaaatgaggcgaagggagcggagttgcgaggcgccgagattgaccaggtggttcctgca
gcacagcccccctcccttgtcagctgtgagaaaaaagacaacatgttgccttttgtgggc
ttgaacaacctgggcaacacctgctacctgaacagcgtcctgcaggtattatatttttgt
cctggttttaaaactggagtaaaacatttatataacattatttcaaagaagagagaatct
tcaaaggatgaaggagagcaaaaggcagaaaagggaagctgtaaagaagatcctttggca
agttacgagctcatctgcagtttgcactccttgatcctttcagttgagcagcttcaagcc
agttttctcctaaacccagagaaatacacggatgaattggccactcagccccgaaggctg
ctgaacaccctcagagagctgaaccccatgtacgaagggtacctgcagcacgatgcccag
gaggtcctgcagtgtatcctggggaacatccaggaaacctgccagctgctgaagaaggaa
gagctgaacaaactgcctgtggaagagcctgcagcgaaactggaggaaaaacccaaccaa
aactctgagagcaatgggtctgtcagccctgctgaggcagaggatcccaccccgggcagc
cacggcggagacgcggccaaggagaagctgctcaaggcaaacgggaaaaggaaaagcgac
gccgagggcggcaacgccaagaaaaaatccaaagtatcaaaagagcaaattgcagcagaa
gaaaatcaaagacaaaccaggtccaagaggaaagccacgggagaaaagatggaaaaccaa
acggacgccattgccaagtgttctggggacagcgagagcgccaagcccacgcagaaaaag
tcgcgccttaggttaaactggttaaaatcttcctgcagacagcccagtattctgtccaaa
ttttacagtctaggaaagttaactacaaacttgggatccaaagagccagggaaagaatat
gactgtgagtttgaagagtcagctgtcaagtgtgaaaatggtgacagtaaagaagaatat
cgtgaaccagcgtctcccttggaaagccatcatggaaaaggaactgaaaaagaaccaaaa
aaggaaggtactgagctggctgtcttcgagctggtggagaaactcttccagggccagtta
gtgctgaggacgaggtgcttggagtgcgagtgcttcacggaaaggagggaggattttcag
gacatcagtgtcccagtgcaagaagatgaactttctaaaagtgaagagagttctgaaatt
tctccagagccaaaaacagaaatgaagactctgaaatgggcaatttcccagtttgcctca
gtggagaggattgtgggagaggacaagtatttctgtgagaactgccaccactacacggaa
gctgagcgcagccttttgttcgataaaatgcccgaagtgatcacaattcacttgaagtgc
tttgctgccagtggcttggagtttgactgctacgggggcctgtccaagatcaacacgccg
ctgctgacgccgctccggctgtccctggaggagtggagcacgcggcccaccaacgacacc
tacgggctcttcgccgtggtcatgcacagcggcatcaccatcagcagcggccactacacg
gcctcggtgaaggtcaccgacctgcagagcctggagctggacaggggcaacttcctcccc
gagccgggctacgccgcgctcaagccggagccgctgaccgaggaggaggcgcgcgccgtg
gccgaggactacgacgacggcgaggtctccttcaggcccagcggcgccgcgccgccgggc
aaggtgctcagcaagaagaacatggaggccgtggggctgctcggggggcagaagagcaag
gctgactgtgagctgtgtgccagcaaacagcccaaccccgagaagctcctgagcgtggct
cccgagccccgcagcgagcccagcgccgagcccagggcggagcagggcgagcccacggcg
ctgggagccaatggactggagaacaaagccctctacgtgctccagagcctcaaggagtac
gaggggaagtggctgctcttcgacgattctgaagtgaaggtcacagaggaaaaggacttt
ctgaattctctttctccgacatcgtcatctacatcgactccttacctactgttttataag
aaaattgtagagtga

DBGET integrated database retrieval system