KEGG   Taeniopygia guttata (zebra finch): 100218458Help
Entry
100218458         CDS       T01082                                 

Definition
guanidinoacetate N-methyltransferase A-like
Orthology
K00542  
guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100218458
   00330 Arginine and proline metabolism
    100218458
Enzymes [BR:tgu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     100218458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
28
AA seq 145 aa AA seqDB search
MSSGAAGGPIFAQGEDCRAAWREARAGYDEPDAHLEILGKPVMERWETPYMHSLATVAAS
KGGRVLEVGFGMAIAASKVQQFGIEEHWIIECNEGVFRRLEQWAEAQPHKVVPLKGLWED
VVPTLPDGHFSGILYDTYPLRDKVH
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgagctccggagcggcgggggggcccatattcgctcagggcgaggactgccgggcggcc
tggagggaagccagggcgggctacgacgagcccgacgcacacctggagatcctgggcaag
ccggtgatggagcgctgggagacgccctacatgcactcgctggccaccgtggccgcgtcc
aagggcggccgtgtgctggaggtggggtttgggatggccatcgccgcctccaaggtgcag
cagttcggcatcgaggagcactggatcatcgagtgcaacgagggcgttttccggcgcctg
gagcagtgggccgaggcacagccgcacaaggtggtgcccctgaaggggctgtgggaggac
gtggtgccaacgctgccggacgggcacttcagcgggatcctgtacgacacctacccgcta
agggataaagtccattaa

DBGET integrated database retrieval system