KEGG   Taeniopygia guttata (zebra finch): 100218485Help
Entry
100218485         CDS       T01082                                 

Definition
(RefSeq) mitogen-activated protein kinase 14-like
Organism
tgu  Taeniopygia guttata (zebra finch)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 176 aa AA seqDB search
VALCCSSAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENQWYLVTHLMGA
DLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGL
ARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTD
NT seq 529 nt NT seq  +upstreamnt  +downstreamnt
gttgctctgtgttgcagttctgcctttgacacaaaaactggtttgagagtggcagtgaag
aagctgtcccggcccttccagtccatcatccacgccaagagaacctaccgggagctgcgg
ctgctcaagcacatgaagcatgaaaatcaatggtacttggtgacacatctcatgggagca
gacctgaacaacattgtgaaatgccagaagctcactgatgaccacgtgcagtttctcatt
taccagatccttcgaggcctgaagtacatccattcagctgacataatacacagggattta
aaacccagtaacttagctgttaatgaagactgtgagctgaagatcctggatttcgggctg
gcccggcacacggatgatgagatgaccgggtacgtggccacccggtggtacagggctccc
gagatcatgctgaactggatgcactacaaccagacagttgatatttggtcagtgggatgc
attatggctgagctgttgactggaagaacattgttccctggcacagacc

DBGET integrated database retrieval system