KEGG   Taeniopygia guttata (zebra finch): 100218485Help
Entry
100218485         CDS       T01082                                 

Definition
mitogen-activated protein kinase 14-like
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Influenza A
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100218485
   04370 VEGF signaling pathway
    100218485
   04068 FoxO signaling pathway
    100218485
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100218485
   04621 NOD-like receptor signaling pathway
    100218485
   04622 RIG-I-like receptor signaling pathway
    100218485
  Endocrine system
   04912 GnRH signaling pathway
    100218485
   04914 Progesterone-mediated oocyte maturation
    100218485
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100218485
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100218485
   05164 Influenza A
    100218485
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100218485
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100218485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 173 aa AA seqDB search
SAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENQWYLVTHLMGADLNNIV
KCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDD
EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDRIL
NT seq 523 nt NT seq  +upstreamnt  +downstreamnt
ttctgcctttgacacaaaaactggtttgagagtggcagtgaagaagctgtcccggccctt
ccagtccatcatccacgccaagagaacctaccgggagctgcggctgctcaagcacatgaa
gcatgaaaatcaatggtacttggtgacacatctcatgggagcagacctgaacaacattgt
gaaatgccagaagctcactgatgaccacgtgcagtttctcatttaccagatccttcgagg
cctgaagtacatccattcagctgacataatacacagggatttaaaacccagtaacttagc
tgttaatgaagactgtgagctgaagatcctggatttcgggctggcccggcacacggatga
tgagatgaccgggtacgtggccacccggtggtacagggctcccgagatcatgctgaactg
gatgcactacaaccagacagttgatatttggtcagtgggatgcattatggctgagctgtt
gactggaagaacattgttccctggcacagaccgtatcctttag

DBGET integrated database retrieval system