KEGG   Taeniopygia guttata (zebra finch): 100218507Help
Entry
100218507         CDS       T01082                                 

Gene name
GBA2
Definition
glucosidase, beta (bile acid) 2
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tgu00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tgu00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Z
AA seq 826 aa AA seqDB search
MAAAVETVEWPLMRRYEGAAQGRGVAADGWRTLGYFRWWVKKTCIEKKTAFIDLLCAVPL
QQIYGCPLGGIGGGTITRGWRGEFCRWQLNPGLYHYGTVIANQFTVCLRCKGQTIYQQVL
SMERPSSLQGWNWGYCGHYAFYHALYPRAWLVYELPGQQVVLTCRQVSPVIPHDYKDSSL
PVGVFIWEVENRRDEDVEVSIMFSLQNGMGTKEDGSGGHWNEPFTFQKDGERVAGVLLHH
CPAVNPFTLAISAREKAGTGVTHVTAFNPTGLGREVWQDLLQDGRLDSPAGKSRPTEKGE
VTAAAVCASCRVPAHGHKTLEMALAWDMPCVHFGSKEKLHVRRYTRFFGSKGDAAPTLSH
YALTHYEEWERKIEAWQNPILENSQLPAWYKSALFNELYFMTDGGTIWVEVPPDCCAEDL
QGPAGAGLSHLLPVLREYGRFAYLEGQEYRMYNTYDVHFYASFALIMLWPKLQISLQYDI
AVTVVNEDVQPRQYLMGGQTAQVKMKNVVPHDIGDPGDEPWQRVNAYLMHDTADWKDLNL
KFVLQVYRDYYLTHDSLYLQDMWPVCQAVMESELKFDTDNDGLIENGGFADQTYDAWVVI
RRCAYCGGLWLAAVCMMCKMAEVLGDTEIRQKYLGILNKGKEAFERMLWNGKYYNYDSSG
SDTSSSIMSDQCAGQWFLGACGLDQGEFEVFPKSHILSALRTIFEKNVLSFAGGTMGAVN
GMRPDGVPDTSSVQSNEVWVGVVYSLAATMIQEGMVEEGFRTAEGCYRTVWERLGMAFQT
PEAYREKKVYRSLAYMRPLSIWSMQLALERRAGQAPAQLPQSYTHP
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggtggagacggtggagtggccgctgatgcggcgctacgagggggcagct
cagggccgcggcgtggcggcggacggctggcgcaccttaggatacttcaggtggtgggtc
aagaagacttgcatagagaagaaaactgccttcattgacctcttgtgtgctgttcctctg
cagcagatctatgggtgcccgctgggcggcatcgggggaggcaccatcacccgtggctgg
cgaggagagttctgccgctggcagctgaaccctggcctttaccactatggaacagtcatc
gccaatcagttcacagtgtgcctgcggtgcaaggggcagaccatttaccagcaggttttg
tccatggagagacccagcagcctgcagggctggaactggggctactgcggccactacgcc
ttttaccatgccctgtacccccgcgcctggctggtctacgagctgccggggcagcaggtg
gtgctcacctgccggcaggtctctcccgtcatcccccatgactataaggactccagcttg
ccagtgggagtgttcatctgggaggtggagaacaggagggatgaggacgtggaagtgtcc
atcatgttcagcctgcagaacggcatgggaacgaaagaagatgggagcggcgggcactgg
aacgagcccttcaccttccagaaggatggcgagcgggttgctggggtcctgctgcaccac
tgcccggccgtgaaccccttcaccctggccatctctgcccgggagaaggctggcacggga
gtcacccatgttacggcattcaatcccacgggattgggtagagaggtgtggcaggacctc
ctgcaggatggcaggctggattcacccgctggtaaaagcaggccgacagagaagggggag
gtgacagcagcagcagtgtgtgccagctgtagggtgcctgcccatgggcacaagacgcta
gagatggccctggcttgggacatgccctgtgtccactttggctccaaggagaagctgcat
gtcaggcggtacacccggttttttggcagcaaaggtgatgctgctcctaccctgtcccat
tacgccctgacacactacgaggagtgggagaggaagattgaagcatggcagaatcccatc
ctggagaacagccagctgcctgcctggtacaagtcagccctcttcaatgagctctacttc
atgacggatggagggaccatctgggtggaggtgccccctgattgctgtgccgaggacctg
caggggccggcgggggcggggctctcccacctcctccctgtcctgcgggagtacgggaga
tttgcttatttggaaggccaggagtaccggatgtacaacacctacgatgtccatttctac
gcctccttcgctctcatcatgctgtggcccaagctgcagatcagcctgcagtatgacatt
gctgtcactgtggtgaatgaggatgtccagccccggcagtacctgatgggtggtcagaca
gcccaggtgaagatgaagaatgtggtgccacatgacattggggacccaggtgacgagccg
tggcagcgtgtcaatgcctacctgatgcacgacactgctgactggaaggacctcaacctg
aagtttgtgctgcaggtgtaccgtgactactacctgacacatgattccctgtacctgcag
gacatgtggccagtgtgccaggctgtgatggagtcagagctgaagtttgacacggacaac
gatgggctcattgaaaatggtggctttgctgaccagacgtacgacgcgtgggtggtcatc
agacgatgtgcctactgtggtggactgtggctggctgccgtgtgcatgatgtgcaagatg
gcagaggtgcttggggatacggagatccggcagaaatacctgggcatcctgaacaagggc
aaggaggcgtttgagaggatgctctggaatggaaaatactacaactatgatagcagtgga
agtgacacatccagcagcatcatgtcagaccagtgtgctgggcagtggtttctcggagct
tgtggtctggaccaaggggagtttgaggttttccccaagagtcacattctcagcgcgctc
aggaccatctttgagaagaacgtgctgagcttcgcaggcggcaccatgggggccgtgaac
ggcatgagacccgatggtgtgcccgacacctccagcgtgcagtccaacgaggtctgggtc
ggtgtggtctactccctggctgccaccatgatccaggagggcatggtggaggaaggcttc
cgtacggcagagggctgctaccggacggtgtgggaacggctgggcatggctttccagaca
cctgaggcctatcgggagaagaaggtgtaccgctcactggcctacatgcggcccctcagc
atctggagcatgcagctggccctggagcgccgggctggccaggcacccgcacagctcccc
cagagctacacccacccttga

DBGET integrated database retrieval system