KEGG   Taeniopygia guttata (zebra finch): 100218534Help
Entry
100218534         CDS       T01082                                 

Gene name
GLA
Definition
galactosidase, alpha
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100218534 (GLA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    100218534 (GLA)
   00600 Sphingolipid metabolism
    100218534 (GLA)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    100218534 (GLA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100218534 (GLA)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100218534 (GLA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4A
AA seq 415 aa AA seqDB search
MAAARRTLCWVAVAAAAAAAAMALDNGLARTPPMGWLHWERFLCGTDCAAEPRRCVSEQL
FVEMADRMAAEGWRDAGYEFICIDDCWMAPTRDGQGRLQADPKRFPGGIRKLADYVHSKG
LKLGIYSDVGSKTCAGFPGSYNHYDLDAQTFASWGVDLLKFDGCNSDSLEQLAEGYRLMS
LALNKTGRSIVYSCEWPFYLRPVQQPNYTEIKQYCNHWRNFYDVYDSWSSIKSILDWTAL
HQDTIVKIAGPGGWNDPDMLVIGNFGLSWEQSVTQMAMWAIMAAPLFMSNDLRHISPEAK
WLLQNKEVIAINQDPLGKQGYQLSKDKNFQLWERPLVALSGRAYSVAVLNQQEIGGPQKF
TFYLSILGNGLACNPACSIRQVLPASRDCGVYSWLSSLSVEVNPTGTVLLKVLPL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcacggcggacgctgtgctgggttgcggtggcggcggccgcggcggcggcg
gcgatggcgctggacaacggcctggcgcggacaccgcccatgggctggctgcactgggag
cgcttcctctgcggcaccgactgcgccgccgaaccgcgccgctgcgtcagcgagcagctg
ttcgtggagatggcggacaggatggctgccgagggctggagggacgccggctacgagttc
atctgcatcgacgactgctggatggccccgacgcgggacgggcagggccggctgcaggcg
gacccaaagcggttccccggtgggatccgcaagctggccgactacgtccactccaagggt
ctgaagctgggaatctacagtgatgttgggtccaagacgtgtgctggcttccctggcagc
tacaaccactatgacctggatgcccagacatttgcttcctggggtgtggacctgctcaag
tttgatggctgcaactctgactcactggagcagctggcagaaggatacagactcatgtct
ctggccctgaacaagactggaaggagcattgtgtactcctgcgagtggcctttctacctg
aggcctgtgcagcagcccaattacacagagatcaaacagtactgcaatcactggaggaac
ttctatgatgtttatgactcctggagcagcatcaagagtatcttagactggacagcactt
caccaggacaccattgtgaagatagctgggccagggggctggaatgatcctgatatgctg
gtgattggaaactttgggctgagctgggagcagtcggtgactcagatggccatgtgggcc
attatggccgctcccctgttcatgtccaacgacctgcggcacatcagtcccgaggccaag
tggctgctccagaacaaagaggtgatcgccatcaaccaggacccactgggcaagcaggga
taccagctttccaaggacaagaactttcagctgtgggagcggcccctcgtcgctctgtct
ggccgagcttattctgtggccgtgctgaaccagcaggagattggaggaccccagaagttc
actttctatctctcgatcctcggcaacgggctggcctgcaacccagcctgctccatccga
caggtgctgccagccagcagggactgcggcgtgtacagctggctctcctccctgagcgtg
gaggtgaaccccacgggcactgtgctgctcaaagtcctgccactgtag

DBGET integrated database retrieval system