KEGG   Taeniopygia guttata (zebra finch): 100218599Help
Entry
100218599         CDS       T01082                                 

Gene name
HDAC2
Definition
histone deacetylase 2
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Cell cycle
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100218599 (HDAC2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100218599 (HDAC2)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100218599 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKADVKEEDKAKDSSGEKTDAKGA
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcagggcggcggcaagaagaaagtctgctattattacgacggtgatatt
ggaaactattactatggacaaggacatccaatgaaacctcacagaatccgaatgactcac
aacttgctgctaaactatggcttatacagaaaaatggagatttatcgaccccacaaagca
actgctgaggaaatgaccaagtaccatagtgatgaatacatcaaatttctccgatcaata
aggcctgacaatatgtctgagtacagcaagcaaatgcagagatttaatgttggagaagat
tgtcctgtatttgatggcctgtttgagttttgtcagctgtcaactggaggctctgttgct
ggggcagtgaaattgaacagacaacaaacagacatggctgtcaattgggctgggggactt
caccatgccaagaaatcggaggcatctggtttctgttatgtcaatgatattgtgcttgcc
atccttgagttactgaagtatcaccaaagagtgttgtatattgatattgatatccatcat
ggtgatggtgttgaagaagcattttataccacagatcgtgtcatgacagtatcattccat
aagtatggtgaatattttccaggcacaggggaccttagggacattggtgctggaaaaggc
aaatactatgctgtcaactttccaatgagggatggtatagatgatgaatcatatggacag
atattcaaaccaattatatctaaagtaatggagatgtaccagcccagtgctgtggtattg
cagtgtggagcagattcactgtctggggacagactgggatgctttaatcttactgttaaa
ggtcatgctaaatgtgtggaagttgtaaagacttttaacttgccattgctgatgttagga
ggaggaggctacacaattcgtaatgtggctcgatgctggacatacgaaactgctgttgcc
ttagattgtgaaattcctaatgagttgccatacaatgactacttcgagtattttggacca
gacttcaagcttcatattagtccttcaaatatgactaatcagaatacaccagaatatatg
gagaaaatcaagcaacgcttatttgagaacttgcgcatgttacctcatgcacctggtgta
cagatgcaggccattcctgaagatgctgttcatgaagacagtggagacgaggatggagaa
gatccagacaaacgcatttctattcgagcatctgataagcgcatagcttgtgatgaagaa
ttttcagattctgaagatgaaggggaaggtggacgacgaaacgttgcggatcataagaaa
ggagcgaagaaagccagaatagaagaagacaaaaaagagactgaggacaaaaaagcagat
gttaaggaggaggataaagccaaggacagcagtggtgaaaagacagacgccaaaggagca
aaatcagaacagctcagcaacccttga

DBGET integrated database retrieval system