KEGG   Taeniopygia guttata (zebra finch): 100218653Help
Entry
100218653         CDS       T01082                                 

Gene name
ALAD
Definition
aminolevulinate dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tgu00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
17
AA seq 267 aa AA seqDB search
MQADSVLHSGYFHPVLRSWQCTATTFDASNLIYPIFVTDSPDAVEPIPSLPGQARYGVNK
LEGMLRPLVEDGLKCVLIFGVPSKVHKDERGSAADAEGTPAIQAIRKISSTFPELLIACD
VCLCPYTSHGHCGILREDGTIQNELSCQRLAEVALAYAKAGCHIVAPSDMMDGRIAAIKQ
ALISNDLGNKVSVMSYSAKFASCFYGPFRDAALSKPAFGDRRCYQLPPGARGLAVRAVIS
SFAGADIIITYFTQQLLRWLREAAGRH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagactccgttctccacagtggatacttccaccccgtgctgcgctcctggcag
tgcacggccaccaccttcgatgcctccaacctcatctaccccatctttgtcactgacagc
cctgatgccgtggagccgattcccagccttcctggacaagccaggtatggagtgaacaag
ctggaggggatgctgcggccccttgtcgaagacggcctcaagtgtgtgctcatctttggg
gtgcccagcaaggtccacaaggacgagagaggctctgctgctgatgccgagggcactcct
gccatccaggccatcaggaagatcagctccaccttcccagagctgctgattgcctgcgat
gtctgcctgtgcccttacacctcacatgggcactgtggcatcctgcgtgaagatggcacc
atccagaacgagctcagctgccagcggctggcagaggtggcgctggcttatgccaaagca
ggctgccacatcgtggccccctcggacatgatggacgggcgcattgcagccataaagcag
gcgctgatctccaacgatctgggcaacaaggtctcagtgatgagctacagcgccaagttc
gcttcctgcttctacggccccttcagggacgcagcgctgtccaaacctgcctttggggac
cggcgctgttaccagctgcccccgggcgcccgcgggctggccgtgcgcgctgtgatctcg
tctttcgcaggggccgacatcatcatcacgtacttcacacaacagctgttgcgctggctg
cgggaagcggcgggccggcactga

DBGET integrated database retrieval system