KEGG   Taeniopygia guttata (zebra finch): 100218671Help
Entry
100218671         CDS       T01082                                 

Definition
(RefSeq) peroxisomal bifunctional enzyme-like
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00071  Fatty acid degradation
tgu00280  Valine, leucine and isoleucine degradation
tgu00310  Lysine degradation
tgu00380  Tryptophan metabolism
tgu00410  beta-Alanine metabolism
tgu00640  Propanoate metabolism
tgu00650  Butanoate metabolism
tgu01100  Metabolic pathways
tgu01200  Carbon metabolism
tgu01212  Fatty acid metabolism
tgu03320  PPAR signaling pathway
tgu04146  Peroxisome
Module
tgu_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
tgu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
tgu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100218671
   00650 Butanoate metabolism
    100218671
  Lipid metabolism
   00071 Fatty acid degradation
    100218671
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100218671
   00310 Lysine degradation
    100218671
   00380 Tryptophan metabolism
    100218671
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100218671
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100218671
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100218671
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     100218671
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100218671
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     100218671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N 3HCDH NAD_binding_2 TrkA_N F420_oxidored
Motif
Other DBs
NCBI-GeneID: 100218671
NCBI-ProteinID: XP_002198586
Position
Un
AA seq 459 aa AA seqDB search
QPLGPRRLSLKPIPRLPNMEAFLREALVKVKKQARGCLAPELCFQAVRAAAERPFAEGVR
RERELFQVLLTSGQARALQYAFFAERAVRRWDTPSGASWSSAAPQPVRKAAVIGLGTMGR
GIVTSLVKANIPLVALEQDLEYLNKGRKAVMLLLEREAMKMERGAQALDFHNPARLQFTV
DFDLLHDVDLVIEAVFENMALKKEIFHKLSKICKPGALLCTNTSALNIDEIASATSCPQQ
VIGTHFFSPAHVMRLLEIIYGRHTSPTAIATAMQLAKALKKVGVVVGNCFGFVGNRMMFP
YVQQAVFLLEEGSRPEAVDQVLEDFGFKLGPFRMSDLAGLDVGWRSRKDQGLTGPSLPAG
TPARQRQGQRYSPLPDLLCEQGRFGQKTGKGWYQYERAGGRTATPDPWLHSFLSHYRDTH
HIKTRFIDQEEILERCLFSLINEGFAILAEGIASGPEHL
NT seq 1379 nt NT seq  +upstreamnt  +downstreamnt
gtcagcccctgggaccccgcaggctcagccttaagccaattccccgactgcccaacatgg
aagcgtttctgcgtgaagctcttgtgaaggtgaagaaacaggcgcgggggtgcctggctc
cggagctgtgcttccaggccgtgcgagccgccgccgagaggccctttgccgagggggtgc
ggcgggagcgggagctgttccaggtgctgctgacctcggggcaggcccgggcgctgcagt
acgccttcttcgccgagagagccgtgcgcaggtgggacactcccagcggagcctcctgga
gcagcgctgccccgcagcccgtgcgcaaggccgccgtcatagggttgggaacgatgggcc
gaggcattgtgacttctctggttaaggccaacatacctttggtagccctggaacaggatc
tggaatatctgaacaagggaagaaaagctgtgatgctcctgttggaacgtgaggctatga
aaatggagaggggtgcccaggccctggatttccataaccctgcacgtctccagttcactg
tggactttgatctgttgcatgatgtagacctagtcatcgaggctgtgtttgagaacatgg
cactgaagaaggaaatattccacaagctgtcaaagatctgcaagccaggagccttgctgt
gtacaaacacatcagccctgaacatcgacgaaatagcttctgccacgagctgcccacagc
aggtcattggcacccacttcttctcccctgcccacgtgatgaggctgctggaaatcatct
acggccgccacacgtcccccaccgccatcgccactgctatgcagctggccaaagccttga
aaaaagtgggagtggtggtagggaattgttttgggtttgttgggaatcgcatgatgtttc
cgtacgtccagcaagcagttttccttttagaggaaggaagcagaccagaagcagtagatc
aggttcttgaagattttggctttaagctaggccctttccgcatgtctgacctggctgggc
tggatgtgggctggaggtctcggaaggatcagggcctgactggaccatccctccctgcag
gcacgccggcccggcagcggcagggccagcgctacagccccctgccagacctgctgtgtg
agcagggccgcttcggccagaaaaccggcaagggctggtaccagtacgagcgggctgggg
gcaggacagccacgccagacccatggctccacagcttcctgtcccactacagagacaccc
atcacatcaagacccgctttatagaccaggaggaaatcctggagcggtgtttgttttccc
tcatcaacgaggggtttgccatcctggctgagggaatagcatcaggcccagagcacctg

DBGET integrated database retrieval system