KEGG   Taeniopygia guttata (zebra finch): 100218704Help
Entry
100218704         CDS       T01082                                 

Definition
putative calcium-activated potassium channel subunit beta-like
Orthology
K04937  
potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    100218704
Ion channels [BR:tgu04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   100218704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 200 aa AA seqDB search
MLGKKLVTAQKRGETRALCLGLGMVACSVMMYFFIGITIVPFYTKSVWTTETVCKVLKAN
IKDKVFCPNSKGPEDEEIFPYPCLQVWVNLTASGQEVMLYQTEDTLERNPKCSYVPDKLE
NSKEVKARIEIIASNFKKYQTFPCYYDPGGTQTNVILSRLYPAKALLFAFLWPTLMFTGG
CLIVFLVKISQYVSVLSAWQ
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgctgggaaagaagttggtgactgcacaaaagcgaggggagacaagagcgctatgcctc
ggactgggaatggttgcatgctccgtgatgatgtacttttttattgggatcaccattgtg
ccattttacactaagagtgtttggacaacagaaactgtgtgcaaggtactcaaagccaac
atcaaggacaaagttttctgcccaaatagcaaaggcccagaggatgaggaaatctttcct
tatccttgtctacaagtgtgggttaatctgacagcctcaggacaggaggttatgctctac
cagactgaagatacactggaaagaaatcctaagtgctcatacgtcccagacaagttggag
aactctaaagaagttaaggcacgaatagaaataattgcaagcaatttcaaaaaataccag
actttcccatgttactatgacccaggaggaacacagaccaacgtcattttaagcagactt
tatcccgcaaaagctctcctctttgctttcctctggcctacactcatgtttactggtgga
tgtctgattgtttttctggtaaaaattagtcagtatgtttctgttctttctgcttggcag
taa

DBGET integrated database retrieval system