KEGG   Taeniopygia guttata (zebra finch): 100218726Help
Entry
100218726         CDS       T01082                                 

Gene name
MAPK6
Definition
mitogen-activated protein kinase 6
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 721 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSRLTDDVGSLTELNCVYIVQEYMETDLANLLE
QGPLLEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLNVIPVYIRNDMTEPHKPLTQLLPGISPEALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDESHSHIYNWERYHES
QFSDHDWPIHNNYEADEVQRDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTHFS
TEPCWQYSDHHENKYCDLECSHTCNYKMRSSSYLDNLVWRDSEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCEKNGLVKAQIALEEASQQLVEKEREKNQGFDFDSFIAETIQLSLQ
HESTDVDKLNDLNSSVSQIELKGIISKSVSREKQEKGMANLAQLEALYQTSWDSQFVSGG
EGCFLIDQFCCEVRKDEQVEKENTYTSYLDKFFSKKEDAEMLEPEPVEEGKLGEKEREES
FLSNSGELLFNKQLEAIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKHL
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaatttgaaagtctcatgaacattcatggttttgatctgggctctcggtat
atggacttaaaaccactgggctgtggtggaaacggcttagttttttctgctgtcgataat
gactgtgacaaaagagtagctgtcaagaaaattgtcctgacagatccccagagtgttaaa
catgctctacgtgagatcaaaattattagaagacttgaccacgataacattgtcaaagta
tttgaaattcttggtcccagtggaagccggttaacagatgacgtgggctccctgacagaa
ttgaactgtgtttacattgtccaggaatacatggagacagatctggctaatttgctagag
caaggccctttactggaagatcatgccagacttttcatgtaccagctgctacgtgggctc
aagtatattcactctgcaaatgttctgcatagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagattggtgacttcggtcttgcacgaatcatggatcct
cattattcccacaagggccatctttctgaaggattggttactaaatggtacagatcgccc
cggcttttgctttctcctaacaactacactaaagccattgacatgtgggctgcaggttgc
atctttgctgaaatgctgactgggaaaacactctttgcaggtgcacatgaacttgaacag
atgcagttgattctagaatcaattcctgtcgtacatgaggaggaccgtcaggagcttctc
aatgtaattccagtttacattagaaatgatatgactgagccacacaaacctttaactcag
ttgcttccaggcatcagtcctgaagcactggactttctggagcaaattttgacatttagt
cccatggatcgattgacagcagaagaagctttgtcccatccttatatgagcatttattcc
tttccaacggatgagcctatttcaagtcatccttttcacattgaagatgaggttgatgat
attctgctaatggatgaaagtcacagccatatttataattgggaaagataccatgaaagt
cagttttcagaccatgactggcctattcataataactatgaagctgatgaagttcagcgt
gatccaagggctctttctgacgtaactgatgaagaagaagtgcaggtagatcctcgcaaa
tatttggatggagatcgtgaaaagtacctggaggatcctgcctttgacacccacttctct
actgagccttgctggcagtattcagatcaccacgaaaacaagtattgtgatctggagtgt
agtcacacttgtaattacaaaatgagatcctcttcatacctagataatttagtttggcga
gacagtgaagttaaccattactatgagcccaagcttattatagatctttcaaactggaag
gaacaaagcaaagaaaagtctgacaagaaaggcaagtctaaatgtgaaaagaatgggttg
gtgaaagctcagatagcacttgaggaagcatcacagcaacttgttgaaaaagaaagggag
aagaatcaggggtttgactttgattcttttatagcagaaaccatccagcttagtttacaa
catgagtctactgatgttgataaattaaatgacttgaatagttcagtgtctcagatagag
ttgaaaggaataatatcaaagtcggtaagcagagagaaacaggagaaaggaatggccaac
ttggcacagttagaagctctgtaccaaacttcttgggacagtcagtttgtcagtggtggg
gagggatgcttcctcatagaccagttctgttgcgaagtaaggaaagatgaacaagttgaa
aaagaaaatacttacaccagttatttggacaaattttttagtaagaaagaagatgctgaa
atgctagaacctgagccagtagaagaggggaagcttggggagaaggaaagagaagagagc
tttctcagtaacagtggggaactcctcttcaacaagcagcttgaggctataggtattcct
cagtttcacagccctgttggctctcctctcaaatccatccaggccacactaacgccttct
gctatgaaatcatctccccagattccccacaaaacctacagcagcattctgaaacatcta
aactaa

DBGET integrated database retrieval system