KEGG   Taeniopygia guttata (zebra finch): 100218846Help
Entry
100218846         CDS       T01082                                 

Gene name
PDK1
Definition
pyruvate dehydrogenase kinase, isozyme 1
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100218846 (PDK1)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100218846 (PDK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 408 aa AA seqDB search
MRLLRALLRGAAAGNIPQQVDFYSRFSPSPLSMKQFLDFGSENACEKTSFMFLRQELPVR
LANIMKEISLLPDNLLRTPSVQLVQSWYVQSLQEILDFKDKSSEDSGAIHSFTDTVIKIR
NRHNDVIPTMAQGVIEYKESFGIDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKI
NPAHPKHIGSIDPNCNVVEVIRDGYENAKTLCDLYYMSSPELILEELNSKSPGQPMQVVY
VPSHLYHMVFELFKNAMRATMEHHADRSIYPAIHVHITLGNEDLTVKMSDRGGGVPMRKI
DRLFNYMYSTAPRPRVETSRATPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIY
IKALSTESIERLPVYNKAAWKHYKANHEADDWCVPSSEPKDMTTFRSM
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgctgcgcgcccttctgcgcggcgctgccgcgggcaacatcccgcagcaggtg
gacttctactcacgcttctccccctcgccgctctccatgaagcaatttctggacttcgga
tctgaaaatgcttgtgaaaagacttcgtttatgtttctgcgacaagagttgcctgtgaga
ttggcaaacataatgaaggaaataagcttgcttccagacaacctcctaagaacaccttca
gttcagctggtgcagagctggtatgtccaaagtcttcaggagattcttgactttaaggac
aaaagctcagaagattcaggggctattcacagttttacagatactgtgataaaaatccgg
aatcgccacaatgatgtaattcctaccatggctcaaggagtaatcgaatacaaggaaagc
tttggcattgatccagtgacctcacagaacgtgcagtattttttagaccgcttctacatg
agtcgcatttcaatcagaatgctccttaatcaacactctttactgtttggtgggaaaatt
aatccagctcatccaaaacatattggaagcattgatcctaactgcaatgttgttgaagtt
attagagatggctatgaaaatgccaagacactttgtgatttatattacatgagctctcca
gaacttatccttgaagagttgaattctaaatcaccaggacagcctatgcaagtggtgtac
gtgccatcacatctctatcacatggtttttgaacttttcaagaatgcaatgagagccacc
atggaacatcatgctgatcgaagcatttatcctgcaattcatgtacacatcaccttggga
aatgaggatttaactgtgaagatgagtgaccgtggtggtggtgttcctatgaggaaaatt
gacagactgttcaactatatgtattcaacagcaccacgtcctcgtgttgagacatcacga
gctacacctttggctggatttggttatggcttacctatatcacgtctgtatgcacagtac
ttccaaggagacctgaaactgtattccttagaaggctatggtacagatgcagttatttac
atcaaggccttatcaacagaatcaattgaaagactccctgtatacaacaaagcagcctgg
aaacattataaagcaaaccatgaagctgatgactggtgtgtgccaagcagtgagccaaag
gacatgaccacttttcggagtatgtag

DBGET integrated database retrieval system