KEGG   Taeniopygia guttata (zebra finch): 100218846Help
Entry
100218846         CDS       T01082                                 

Gene name
PDK1
Definition
pyruvate dehydrogenase kinase, isozyme 1
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 408 aa AA seqDB search
MRLLRALLRGAAAGNIPQQVDFYSRFSPSPLSMKQFLDFGSENACEKTSFMFLRQELPVR
LANIMKEISLLPDNLLRTPSVQLVQSWYVQSLQEILDFKDKSSEDSGAIHSFTDTVIKIR
NRHNDVIPTMAQGVIEYKESFGIDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKI
NPAHPKHIGSIDPNCNVVEVIRDGYENAKTLCDLYYMSSPELILEELNSKSPGQPMQVVY
VPSHLYHMVFELFKNAMRATMEHHADRSIYPAIHVHITLGNEDLTVKMSDRGGGVPMRKI
DRLFNYMYSTAPRPRVETSRATPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIY
IKALSTESIERLPVYNKAAWKHYKANHEADDWCVPSSEPKDMTTFRSM
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgctgcgcgcccttctgcgcggcgctgccgcgggcaacatcccgcagcaggtg
gacttctactcacgcttctccccctcgccgctctccatgaagcaatttctggacttcgga
tctgaaaatgcttgtgaaaagacttcgtttatgtttctgcgacaagagttgcctgtgaga
ttggcaaacataatgaaggaaataagcttgcttccagacaacctcctaagaacaccttca
gttcagctggtgcagagctggtatgtccaaagtcttcaggagattcttgactttaaggac
aaaagctcagaagattcaggggctattcacagttttacagatactgtgataaaaatccgg
aatcgccacaatgatgtaattcctaccatggctcaaggagtaatcgaatacaaggaaagc
tttggcattgatccagtgacctcacagaacgtgcagtattttttagaccgcttctacatg
agtcgcatttcaatcagaatgctccttaatcaacactctttactgtttggtgggaaaatt
aatccagctcatccaaaacatattggaagcattgatcctaactgcaatgttgttgaagtt
attagagatggctatgaaaatgccaagacactttgtgatttatattacatgagctctcca
gaacttatccttgaagagttgaattctaaatcaccaggacagcctatgcaagtggtgtac
gtgccatcacatctctatcacatggtttttgaacttttcaagaatgcaatgagagccacc
atggaacatcatgctgatcgaagcatttatcctgcaattcatgtacacatcaccttggga
aatgaggatttaactgtgaagatgagtgaccgtggtggtggtgttcctatgaggaaaatt
gacagactgttcaactatatgtattcaacagcaccacgtcctcgtgttgagacatcacga
gctacacctttggctggatttggttatggcttacctatatcacgtctgtatgcacagtac
ttccaaggagacctgaaactgtattccttagaaggctatggtacagatgcagttatttac
atcaaggccttatcaacagaatcaattgaaagactccctgtatacaacaaagcagcctgg
aaacattataaagcaaaccatgaagctgatgactggtgtgtgccaagcagtgagccaaag
gacatgaccacttttcggagtatgtag

DBGET integrated database retrieval system