KEGG   Taeniopygia guttata (zebra finch): 100219304Help
Entry
100219304         CDS       T01082                                 

Gene name
ECHS1
Definition
enoyl CoA hydratase, short chain, 1, mitochondrial (EC:4.2.1.17)
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100219304 (ECHS1)
   01212 Fatty acid metabolism
    100219304 (ECHS1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100219304 (ECHS1)
   00650 Butanoate metabolism
    100219304 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    100219304 (ECHS1)
   00071 Fatty acid degradation
    100219304 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100219304 (ECHS1)
   00310 Lysine degradation
    100219304 (ECHS1)
   00380 Tryptophan metabolism
    100219304 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100219304 (ECHS1)
Enzymes [BR:tgu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100219304 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 301 aa AA seqDB search
MAAPLRALLRPAARAAAAALPRARLPPPLRAPRGARGCSAGAAFQYLLVQKTGAQKNVGL
IQLNRPQALNALCEGLMAELRRALEAMESDPEVGAIVLTGSQKAFAAGADIKEMQNKTFQ
ECYSSGFLAGWDKVSVVRKPIIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAKEAKEAGLVSKIYPVEKLLDAAIACAEKI
ASNSKLVTAMAKESVNAAFETTLTEGNRTEKRLFYATFATSDRKEGMTAFVEKRKANFTD
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggccgccccgctgcgagcgctcctgcgccccgccgcccgcgccgccgccgccgcgctg
ccccgagcgcgcctcccgccgccgctccgcgccccccgcggcgcacggggctgcagcgcc
ggggctgcattccagtacctgctggtacagaagacgggggcacagaagaacgtggggctg
atccagctgaaccggccgcaggcgctcaatgcgctctgcgagggactcatggcagagctg
cggcgggcgctggaggccatggagagcgacccggaggtgggagccatcgtcctcaccggc
agccagaaagccttcgcagctggcgcagacatcaaggagatgcagaataaaaccttccag
gagtgctacagcagtggcttcctcgccggctgggacaaggtctccgttgtccgcaaaccc
atcatcgccgccgtcaatggctacgccctgggaggcgggtgcgagctggccatgatgtgt
gacatcatctacgctggggagaaggcgcagtttgggcaacccgaaatcctgctgggaacc
atcccaggcgccggcgggacgcagaggctgaccagggcagtggggaagtcgctggcaatg
gagatggtgctcactggggaccgcatttcagcaaaggaggcaaaggaggcaggtctggtc
agcaagatctaccctgtggagaagctgctggacgcagccattgcctgcgctgagaagatc
gccagcaactccaagctggtgactgccatggcaaaggagtcagtcaatgctgccttcgaa
acgacactgacagaggggaacaggacagagaagcgcctcttttacgccacctttgccact
agtgaccgcaaggaggggatgacagcattcgtggagaagcgcaaggccaacttcaccgac
agctga

DBGET integrated database retrieval system