KEGG   Taeniopygia guttata (zebra finch): 100219304Help
Entry
100219304         CDS       T01082                                 

Gene name
ECHS1
Definition
(RefSeq) enoyl-CoA hydratase, short chain 1
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00062  Fatty acid elongation
tgu00071  Fatty acid degradation
tgu00280  Valine, leucine and isoleucine degradation
tgu00310  Lysine degradation
tgu00380  Tryptophan metabolism
tgu00410  beta-Alanine metabolism
tgu00640  Propanoate metabolism
tgu00650  Butanoate metabolism
tgu01100  Metabolic pathways
tgu01200  Carbon metabolism
tgu01212  Fatty acid metabolism
Module
tgu_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
tgu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
tgu_M00085  Fatty acid biosynthesis, elongation, mitochondria
tgu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100219304 (ECHS1)
   00650 Butanoate metabolism
    100219304 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    100219304 (ECHS1)
   00071 Fatty acid degradation
    100219304 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100219304 (ECHS1)
   00310 Lysine degradation
    100219304 (ECHS1)
   00380 Tryptophan metabolism
    100219304 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100219304 (ECHS1)
Enzymes [BR:tgu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100219304 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 100219304
NCBI-ProteinID: NP_001155282
UniProt: B5FXI3
Position
6
AA seq 301 aa AA seqDB search
MAAPLRALLRPAARAAAAALPRARLPPPLRAPRGARGCSAGAAFQYLLVQKTGAQKNVGL
IQLNRPQALNALCEGLMAELRRALEAMESDPEVGAIVLTGSQKAFAAGADIKEMQNKTFQ
ECYSSGFLAGWDKVSVVRKPIIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAKEAKEAGLVSKIYPVEKLLDAAIACAEKI
ASNSKLVTAMAKESVNAAFETTLTEGNRTEKRLFYATFATSDRKEGMTAFVEKRKANFTD
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggccgccccgctgcgagcgctcctgcgccccgccgcccgcgccgccgccgccgcgctg
ccccgagcgcgcctcccgccgccgctccgcgccccccgcggcgcacggggctgcagcgcc
ggggctgcattccagtacctgctggtacagaagacgggggcacagaagaacgtggggctg
atccagctgaaccggccgcaggcgctcaatgcgctctgcgagggactcatggcagagctg
cggcgggcgctggaggccatggagagcgacccggaggtgggagccatcgtcctcaccggc
agccagaaagccttcgcagctggcgcagacatcaaggagatgcagaataaaaccttccag
gagtgctacagcagtggcttcctcgccggctgggacaaggtctccgttgtccgcaaaccc
atcatcgccgccgtcaatggctacgccctgggaggcgggtgcgagctggccatgatgtgt
gacatcatctacgctggggagaaggcgcagtttgggcaacccgaaatcctgctgggaacc
atcccaggcgccggcgggacgcagaggctgaccagggcagtggggaagtcgctggcaatg
gagatggtgctcactggggaccgcatttcagcaaaggaggcaaaggaggcaggtctggtc
agcaagatctaccctgtggagaagctgctggacgcagccattgcctgcgctgagaagatc
gccagcaactccaagctggtgactgccatggcaaaggagtcagtcaatgctgccttcgaa
acgacactgacagaggggaacaggacagagaagcgcctcttttacgccacctttgccact
agtgaccgcaaggaggggatgacagcattcgtggagaagcgcaaggccaacttcaccgac
agctga

DBGET integrated database retrieval system