KEGG   Taeniopygia guttata (zebra finch): 100219382Help
Entry
100219382         CDS       T01082                                 

Gene name
CLOCK
Definition
clock circadian regulator
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100219382 (CLOCK)
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100219382 (CLOCK)
Transcription factors [BR:tgu03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100219382 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 900 aa AA seqDB search
MVKGPRSQQGKSLMVRVTARVTPEWSDRECSLMLGFQECRDDFEGRKFFTISTHKMSSIA
DRNDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVL
QKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGNIIYV
SESITPLLEHLPSDLVDQSVFNFIPEGEHSEIYKILSSHLLESDSLTPEYLKSKNQLEFC
CHMLRGTIDPKEQPTYEYVKFIGNFKCLNHVPNSAHNGFEGTIQRSHRPSYEEKVCFVAT
VRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYH
VDDLDNLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHT
VVSYAEVRAERRRELGIEESLPEITADKSQDSGSDNHINTVSLKEALERFDTSPTPSASS
RSSRKSSHTAVSDHSSTPTKMTVDTSTPPRQGLSGHEKTAQRRSSLSSQSLSSQSLGQPV
TQPAISQPATLQLQSGMTQPVFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQ
EQLQIVHGQGLQMFLQQSASGLNFGSVQLPSGNSSTVQQLTPINMQGQVVQTNQTQSGMN
TGHINTPHMIQQQPLQSTATQHNQQNVLSGHNQQSSLASQSQNTVSAPLYNTMVISQPTG
GNVVQVPSSLPQTNNQNAAAVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMFM
GQVVTAYPTFAAQQQQTQTLSITQQQQQQQQQQSQQDHQQQLTTVQQPAQSQLTQHPQQF
LQTSRLLHGNQSAQLILSAAFPLQQSTFTQSHHQQHQSQQQQLSRHRTDKMTDPSKVQPQ
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggggcctcgatcccagcagggaaagtctctgatggtgagagtgactgccaga
gtgactcctgaatggtcagacagggaatgttccttaatgctgggatttcaagagtgcaga
gatgactttgaggggcggaaattttttaccataagcacccataaaatgagctccattgca
gacagaaatgacggaagcatttttgatgggctggtggaagaagatgacaaagataaagca
aaaagggtgtctagaaacaagtccgaaaagaaacgtcgagatcagtttaatgtacttatc
aaagagttgggttccatgcttccaggtaatgctcggaagatggataaatccactgtgctg
cagaagagcattgactttttacggaagcacaaagaaattactgcacaatcagacgccagt
gaaattcgacaggactggaaaccgacattccttagtaatgaagagttcacacagttaatg
ttagaggctcttgatggtttttttttagcaattatgacagatggaaatataatatatgtg
tctgaaagtataactcccttacttgaacatttgccatctgatcttgtggatcagagtgta
tttaattttatcccagagggggaacattcagaaatttataaaatattgtcttctcatctg
ctggaaagtgattccttgacaccggaatacttaaaatcaaaaaatcagctagaattctgt
tgccatatgctgcgaggaacaatagatccaaaagagcagcccacatatgaatacgtaaaa
tttataggaaatttcaagtgtttgaatcatgttcccaactcagcgcacaatggttttgaa
ggaactattcagagatcacaccggccttcatatgaagaaaaagtttgctttgtagccaca
gtcagattagctacacctcaatttatcaaggaaatgtgcactgttgaagaacccaacgaa
gagttcacatctagacacagcttagaatggaagttcttattcttggatcacagggcacct
ccgataataggttatcttccatttgaagttttgggaacatcagggtatgattattatcat
gtggatgatctggataatctggcaaaatgtcatgagcatttaatgcagtatgggaaaggg
aagtcatgttactacagattccttacaaagggacaacaatggatttggctgcaaactcat
tactatatcacgtatcaccagtggaattccaggccagagtttattgtctgtacgcacact
gttgtgagttatgcagaagttagagcagaaagacgacgagaactgggtattgaggaatct
ctcccagagataacagcagataaaagtcaggactctgggtctgacaatcacataaacaca
gtgagtctcaaagaagcactggaaaggtttgataccagccccacaccttctgcttcctcc
aggagttcaagaaaatcttcacatactgcagtatcggatcattcatcaacaccaactaaa
atgacagtggacactagcactcctccaaggcaaggcttatctggtcatgaaaagactgcg
caaagaagatcatctctgagcagtcagtctttaagctcacagtctcttggacaaccagta
acacagccagcaatatctcagcctgcaactttgcagctccagtctggaatgactcagcct
gtgtttcagttttcagctcaattgggagctatgcagcatctaaaggaccagctagagcaa
agaacacgcatgatagaggcaaatattcatcggcagcaggaagagttgcgtaagattcaa
gagcagcttcaaattgttcatggtcaaggactccagatgttcttgcagcagtcagcttct
ggactcaactttggttctgtgcagcttccttctggaaattcttcaactgttcagcagctt
acgccaataaacatgcaaggtcaagttgttcagactaatcagactcaaagtgggatgaac
acaggccatataaatactccacacatgatacagcagcagcctttgcagagtactgcaaca
cagcataatcaacaaaatgtacttagtggacacaatcaacagtcttctcttgccagtcag
tcacagaacacagtgtcagcacctttgtacaacactatggtgatttctcagccaacagga
ggaaatgtggtgcaggttccctctagcttaccacagaccaacaaccagaatgctgctgca
gtaaccacttttacacaggacagacaaatcagattttctcaaggtcagcaacttgtaaca
aaacttgtcacggccccagtagcatgtggagcggtaatggtaccaagtactatgtttatg
ggacaggtggtgacagcttatcccacttttgctgcccaacagcagcagacacagactttg
tcaataacacaacagcagcagcagcagcaacagcagcaaagtcagcaggaccatcagcag
cagctcaccacagtgcaacaaccagctcagtcacagctgacccagcacccccagcagttc
ctacagacatccaggttacttcatgggaatcagtcggctcagcttattctctctgctgct
ttcccactacaacaaagcactttcactcagtcccaccaccagcagcatcagtctcagcag
cagcagctgtcacgacacagaactgacaagatgactgatccctccaaagttcagccacag
tag

DBGET integrated database retrieval system