KEGG   Taeniopygia guttata (zebra finch): 100219388Help
Entry
100219388         CDS       T01082                                 

Gene name
PLCG2
Definition
(RefSeq) phospholipase C gamma 2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00562  Inositol phosphate metabolism
tgu01100  Metabolic pathways
tgu04012  ErbB signaling pathway
tgu04020  Calcium signaling pathway
tgu04070  Phosphatidylinositol signaling system
tgu04370  VEGF signaling pathway
tgu04625  C-type lectin receptor signaling pathway
tgu04933  AGE-RAGE signaling pathway in diabetic complications
Module
tgu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100219388 (PLCG2)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100219388 (PLCG2)
   04370 VEGF signaling pathway
    100219388 (PLCG2)
   04020 Calcium signaling pathway
    100219388 (PLCG2)
   04070 Phosphatidylinositol signaling system
    100219388 (PLCG2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100219388 (PLCG2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100219388 (PLCG2)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100219388 (PLCG2)
Membrane trafficking [BR:tgu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100219388 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100219388 (PLCG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12
Motif
Other DBs
NCBI-GeneID: 100219388
NCBI-ProteinID: XP_012425216
Ensembl: ENSTGUG00000004405
UniProt: H0Z1Z9
Position
11
AA seq 1265 aa AA seqDB search
MPRKTIDYGVLPEYEKSQIKRTLELGTVMTIFSLKKSSPERRTIQVIMETRQVAWSKTAD
KIEGFLDLMEIKEIRPGKNSKDFERCKARHREEHCFTVFYGTQFVLNTLSLAADSKDDTD
QWLCGLNILYQEVMSAPTPAITESWLRKQIYSVEQTRKNSISLRELKTVLPQVNFKVSSM
KYLKDKFAEIGAHKEELTFEQFHLFYKKIMFEQQKLILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQESWALDLSKVRERMTKFIDDTMRETAEPFLFVDEFLAYLFAKENS
IWDEKYDSIDVQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSEYPVILSIEEHCSVEQQRHMAKV
FKEVFGDQLLMKPVEASADQLPSPTQLKEKIIIKHKKLGPKGDIDVNLEEKKEEKKQQGE
LYMWDTIEQKWTRHYCAIADEKLSFSDDIEQSADEDSSKDLKQTELHLKEKWFHGKMKGG
RTTAEKLLQEYCAEMGGKDGTFLVRESEAFPDDYTLSFWRSGRVQHCRIRSTSDGDTVKY
YLTDNLTFDSIYDLIQHYKEAHLRCAEFELRLTDAVPNPSPHETKDWYYNNLSRGEAEDM
LMRIPRDGAFLIRKRDEPDSFAMTFRAEGKVKHFRIQQEGRHFVLGTSAYFESLVELVTY
YEKHPLYRKMKLRYPVTEELLERYSTEKDINSLYEVRMYVEPSEITPTVPQRTVKALYDY
RAKRSDELSFFRGALIHNVTKETGGWWKGDYGEKVQHYFPSNYVEDLSSDNSAELGNQII
EDNPLGSLCRGILVLNTYNVVKMPQGKHKKPFVFILEPKNPEDPCVEFATDKVEELFEWY
QSIREITWKTAEEENRRKYWEKNQLIAIELSDLVIYCKPTSKTKDNLDNPDFREVRSFVE
TKAESIVKQKPLELLRYNLKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
MQLNHALFSLNGRTGYVLQPESMRNEEYDPMPNDSKRKLQMIMTVRVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLNPIWVPYAEQVKFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATFPIKGIKSGFRSVPLKNGYSEDIELASLLVHCEMQQVLESEEELYSSC
RQLRKRQEELNTQLFLYDSHMNLRNPNRDAILKEFNVNEHKLQIYQDTCNRRLKEKKVSN
SKFYS
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
atgcccagaaagactatagactatggagtgctgcctgagtatgagaaaagccagatcaaa
aggaccttggaattgggaactgttatgacaatattcagtcttaagaagagcagcccagaa
aggaggactattcaagtcataatggaaaccaggcaggtagcatggagcaagacagctgac
aagattgaaggtttcttggatctgatggaaataaaagaaattcgcccaggaaagaattca
aaggactttgaacgttgcaaagcaaggcatagagaagaacactgctttactgttttttat
ggtacccagtttgtcctcaacaccttaagtttagcagctgactctaaagatgatactgat
caatggttgtgtggcttgaatatcttgtatcaagaggtcatgagtgctcccacacctgca
atcacagagagctggctgagaaagcagatctattctgttgaacaaactagaaaaaatagt
atcagtcttagagagctgaaaactgtccttccccaagtaaacttcaaagtgagcagcatg
aagtacttgaaggataaatttgcggaaataggtgcacacaaggaagagcttacttttgaa
caatttcatttgttctacaagaaaatcatgtttgaacagcagaaattgattcttgatgaa
ttcaaaaaggattcctctgttttcattcttggaaatactgaccgcccagatgcttcagca
gttcaccttcacgacttccagagattcctgctacacgagcagcaggaatcttgggcactg
gatctcagtaaagtccgagaacgaatgacaaagttcattgacgacactatgagagaaact
gctgaacctttcctctttgttgatgagttccttgcttacctatttgcaaaagaaaacagt
atttgggatgagaaatatgattcaatagatgtacaggacatgaataacccgttgtcccac
tactggatttcctcctctcataacacatatctgacaggagaccagcttcgcagcgaatcc
tccccagaagcttacatcaggtgcctcaggatgggctgtcgatgtattgagttggattgc
tgggatggtcctgatgggaaacccatcatttaccatggatggacacggacaacaaagatc
aaatttgatgacgtagtgcaggcaatcaaagaccatgcctttgttacatctgaataccca
gtcattctgtcaattgaagagcactgcagtgtggagcagcagcgacacatggccaaagta
ttcaaggaggtgtttggggatcagcttttgatgaagcctgttgaagccagtgcagatcag
ctcccatcaccaacccagctgaaggaaaaaatcatcatcaagcacaaaaaattggggcca
aagggagacattgatgtgaacttggaagaaaagaaagaagaaaagaagcaacaaggagaa
ctttacatgtgggacacaatagagcagaaatggactcgtcactactgcgctattgctgat
gaaaagctttcattcagtgatgatatagaacagagtgctgatgaagattcatccaaggat
ttgaaacaaactgaactgcacttaaaagagaaatggttccatgggaaaatgaaaggaggg
agaacaactgctgagaaactgctccaggaatattgtgctgaaatgggtggcaaggatggg
acattcctggttagggaaagtgaagctttccctgatgactacaccttgtcattctggagg
tcaggcagagtccagcactgccggatccgttccaccagtgatggggacactgtcaaatac
tacctgacagacaacctcacctttgacagcatctatgatctcatccaacactacaaggag
gcccacctgcgatgtgctgagtttgagctgcgcctcactgatgctgtgcccaaccccagc
cctcatgagaccaaagattggtactataacaacttgagtcggggtgaggcagaagacatg
ctcatgcgaattcctcgggatggagcctttctcattagaaagagagatgagcctgattct
tttgccatgactttcagagcggaggggaaggtgaagcacttccgaatccagcaggagggg
cggcacttcgtgctgggaacctcggcctacttcgagagtttggtggagctggtgacctac
tacgagaagcacccgctgtacaggaagatgaagctgcgctaccccgtgacagaggagctg
ctggagcgctacagcacggaaaaagatattaattccctctatgaagtcaggatgtatgtg
gagcccagtgaaatcacccccacagtgcctcagagaacagtgaaagccttgtatgactac
agagcgaaaaggagtgatgaattgagcttctttcgaggagctttaattcataatgtcaca
aaggaaactggaggctggtggaagggggattatggagaaaaagtccaacattattttcca
tctaattatgttgaagatctgtcatctgataactctgctgagcttggaaatcagatcatt
gaggacaacccactgggctctctgtgtcgtggcatcctggtgctcaacacgtacaatgtt
gtgaaaatgccacaaggaaaacacaaaaagccttttgtcttcattctggaacctaagaat
ccagaagatccatgtgttgagttcgcaactgataaagtagaagaactctttgaatggtac
caaagtatccgtgagatcacctggaaaacagcagaagaggagaacaggaggaaatactgg
gaaaagaatcagttaattgctattgaattatctgatctagtaatctactgcaagccaaca
agcaaaaccaaggacaatttagacaatcctgatttcagagaagtccgttcttttgtggag
accaaggcagagagcattgttaagcaaaagccactggagttgctgaggtacaacctgaag
ggcctgactcgtgtctaccccaaaggacagagagttgattcatccaactatgacccattt
cgcctctggctttgtggctcccagatggtggctctgaacttccaaactccagataaatac
atgcaattgaaccatgccttgttttccctgaatggacgcactggctacgtgctgcagcca
gagagcatgagaaatgaggagtatgaccccatgccaaatgactccaagaggaaattgcag
atgattatgacagtgagggttttaggtgctcgtcatctccctaaacttggtagaagcatt
gcctgtccctttgtagaggttgaaatttgtggggctgaatatgataacaacaaattcaag
acaacagttgtgaatgacaatggccttaatccaatttgggtaccttatgcagaacaagtg
aaatttgaaatttacgacccaaatctggcgttcctgcgctttgttgtttatgaggaggat
atgttcagtgatcccaacttcttagcacatgccacttttcccatcaaaggaatcaaatca
ggctttaggtcagttcctcttaagaatggctacagtgaagatatagagctggcctcgctt
ctggtgcactgtgagatgcaacaagttctggaaagtgaagaagaactttattcctcctgt
cggcaactgcggaagcgccaggaggagctgaatacccagctgttcctctatgacagccac
atgaacctgaggaatcccaacagggacgctattctgaaagaattcaacgtcaatgagcac
aaactacagatttatcaagacacttgcaaccgcagattaaaggagaagaaagtcagtaac
agcaaattctactcttag

DBGET integrated database retrieval system