KEGG   Taeniopygia guttata (zebra finch): 100219448Help
Entry
100219448         CDS       T01082                                 

Definition
3'(2'),5'-bisphosphate nucleotidase 1-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100219448
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100219448
Transfer RNA biogenesis [BR:tgu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100219448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 268 aa AA seqDB search
AGPNDLQTKADRLVQMSICASLARKFPKVTIIGEEELPADDVTEDLIEDGHCEEILKKPC
PAQYTGIKEEELVIWVDPLDGTKEYTEGLLDHVTVLIGIAYGGKAIAGVINQPYYNYEAG
ANAVLGRTIWGVLGMGAFGFQLTEAPAGKHIVVTTRSHSSALVNECITALNPDQVIRVGG
AGNKIIQLIEGKASAYVFASPGCKKWDTCAPEAILHAVGGKITDIRGNSFQYNKEVKHMN
SAGVLATLRNYDYYASRIPNTVKESLVP
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gctggacccaatgacttgcagaccaaagctgaccgactggtacaaatgagcatttgtgct
tccctggcacggaagtttcccaaggtgacaatcataggagaagaagagctgcccgctgat
gatgtaactgaagatttaattgaagatggtcactgtgaagaaatactgaagaaaccttgt
cctgctcagtacacaggaattaaagaggaagagcttgtaatatgggttgatcccttggat
ggaaccaaggagtacactgaaggtctccttgaccatgtaacagttcttattggaattgcc
tatggaggcaaagcaatagcaggagttattaaccagccttattacaactatgaggcagga
gctaatgctgtgctgggcaggacaatctggggagtgctgggcatgggtgcctttggcttc
cagctgacagaagcccctgctggcaaacacatcgtggttaccacccgctcccacagcagc
gccctggtgaacgagtgcatcactgccttgaacccagaccaggtcatcagagttggagga
gcaggaaacaagatcattcaactcatagaaggcaaagcatctgcttatgtatttgccagt
cctgggtgcaagaagtgggatacatgtgcacctgaagctatcctacatgctgtgggaggc
aagataactgatatccgtggaaattcatttcagtataacaaggaggtgaagcacatgaat
tcagctggggtccttgccactttgagaaattatgactactatgccagtcgtattccaaac
actgtgaaagaatctcttgtgccttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system