KEGG   Taeniopygia guttata (zebra finch): 100219448Help
Entry
100219448         CDS       T01082                                 

Definition
3'(2'),5'-bisphosphate nucleotidase 1-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:tgu00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 268 aa AA seqDB search
AGPNDLQTKADRLVQMSICASLARKFPKVTIIGEEELPADDVTEDLIEDGHCEEILKKPC
PAQYTGIKEEELVIWVDPLDGTKEYTEGLLDHVTVLIGIAYGGKAIAGVINQPYYNYEAG
ANAVLGRTIWGVLGMGAFGFQLTEAPAGKHIVVTTRSHSSALVNECITALNPDQVIRVGG
AGNKIIQLIEGKASAYVFASPGCKKWDTCAPEAILHAVGGKITDIRGNSFQYNKEVKHMN
SAGVLATLRNYDYYASRIPNTVKESLVP
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gctggacccaatgacttgcagaccaaagctgaccgactggtacaaatgagcatttgtgct
tccctggcacggaagtttcccaaggtgacaatcataggagaagaagagctgcccgctgat
gatgtaactgaagatttaattgaagatggtcactgtgaagaaatactgaagaaaccttgt
cctgctcagtacacaggaattaaagaggaagagcttgtaatatgggttgatcccttggat
ggaaccaaggagtacactgaaggtctccttgaccatgtaacagttcttattggaattgcc
tatggaggcaaagcaatagcaggagttattaaccagccttattacaactatgaggcagga
gctaatgctgtgctgggcaggacaatctggggagtgctgggcatgggtgcctttggcttc
cagctgacagaagcccctgctggcaaacacatcgtggttaccacccgctcccacagcagc
gccctggtgaacgagtgcatcactgccttgaacccagaccaggtcatcagagttggagga
gcaggaaacaagatcattcaactcatagaaggcaaagcatctgcttatgtatttgccagt
cctgggtgcaagaagtgggatacatgtgcacctgaagctatcctacatgctgtgggaggc
aagataactgatatccgtggaaattcatttcagtataacaaggaggtgaagcacatgaat
tcagctggggtccttgccactttgagaaattatgactactatgccagtcgtattccaaac
actgtgaaagaatctcttgtgccttaa

DBGET integrated database retrieval system