KEGG   Taeniopygia guttata (zebra finch): 100219498Help
Entry
100219498         CDS       T01082                                 

Gene name
PRLR
Definition
prolactin receptor
Orthology
K05081  
prolactin receptor
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100219498 (PRLR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100219498 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    100219498 (PRLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Z
AA seq 824 aa AA seqDB search
MKQRYISSVQIIFQLALTTVGLTGQSYPGKPQIIRCRSLEKETFSCWWKPGSDGGLPNNY
TLFYSKDSEEKMYECPDYLTSGPNSCYFDKNHTNPWTTYIITVTATNEIGSNSSDPQHVD
VTSIVQPDAPVNLSLETNISANLSYLWAKWSPPPLADASSNLHVYHYELRLKPEEKEEWE
TVSVGMQTHYEVSSLKAGVKYIVQVRCMLDLGEWSEWSSERSIQIPKEQLPPEKPIIIKC
RSPEKETFTCWWKPASDGGLLTKHTLLYSKEGEEKVYECPDYKTAGPNSCYFNKKHTSFW
TIYNITVRATNEMGSNVSDPHYVDVTYIVQPDPPVNITLELKKSIKRKPYLVLTWSPPPL
ADVRSGWLTLEYELRLKPEEGEEWETIFVGQQTQCKMFSLNPGKRYIVQIHCKPDHHGLW
SEWSPEMYIEIPTDFRVKDMVVWIIVGVLSSLICLIMSWIMIMKGYRMMAFILPPVPGPK
IKGIDTHLLETGKSEELLSALGCHGFPPTSDCEELLIEYLEVEDSEDQQLMPSHDTPSKN
TKIMLKETDSDSGRGSCDSPSLLPVKCRESRSLPSALQTQDVRAKEKKGGKGSWDTRCMA
SEQKTLPCESIKTCTWLAAQLPSNQAAMFAYHSTVEAFKITLNTTNVNNSPVLVGNEENR
QSLYPIAETVYDDVEKVSEMEYSKTDQTTVQVRQNEHSNKSPFLNPKLMDYVEVHKVRQD
EEPTLLLKHKENSGKTKKCTVPGTSKEYTKVSTVVDHHILVLLPDQRSQNTPVSQEPVAE
TSQNPQQSQAEKNTSYSTTAPSDSRRDTSGSDYMDPSSFMPSFK
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagagatacatttcatcagttcaaataatttttcagcttgcactgactacagta
ggtctgactggtcaatcgtaccctggaaaacctcagataataagatgtcgttctctagaa
aaggaaaccttttcatgttggtggaagcctggctcagatgggggactccctaacaattat
accctgttctacagcaaggacagtgaagaaaaaatgtatgaatgtccagactacctaaca
tcaggtccaaattcctgctactttgataaaaaccacactaatccctggacaacatatatt
atcactgtaacggcaacaaatgagattggaagtaacagctcagatcctcagcatgtggat
gtaacttccatagttcagccagatgctcctgtgaacctctctctagaaacaaacatatct
gctaacctgtcatacctttgggcaaaatggtctccacccccattagctgatgccagctct
aatttgcatgtatatcactatgagctacgactaaagcctgaggaaaaggaagaatgggag
acagtatctgtaggaatgcagacacactatgaggtgagcagcctgaaagctggggtgaag
tacattgttcaggtgcgttgcatgttagacctcggagaatggagtgagtggagctcagaa
agaagcattcagatccctaaagaacagttacctcctgaaaagcctataataataaagtgc
cgttctcctgaaaaagaaacatttacttgttggtggaaacctgcttcagatggaggactc
ttgacaaaacatactttgctttacagcaaagagggagaagaaaaagtttatgaatgtcca
gattacaaaactgcaggccccaattcatgctacttcaataaaaagcacacctctttctgg
accatatacaatattactgtgagggcaactaatgaaatgggaagtaacgtctctgatcct
cattatgtggatgtgacttacatagtacagccagatcctcccgtgaatataacgctggaa
ttaaaaaagtcaataaagagaaaaccgtatctggtactgacatggtctccacccccactg
gctgatgtcagatctggatggcttacccttgaatatgaattgagactaaagcctgaagaa
ggagaggaatgggagactatttttgttggacagcaaacacaatgcaaaatgtttagttta
aaccctggaaagaggtatattgtacagattcactgcaaaccagaccaccatggattgtgg
agtgagtggagcccagaaatgtatattgagatccctactgactttagagtaaaagatatg
gttgtgtggatcatcgttggtgtcctgtcatctcttatatgtttaatcatgagctggata
atgattatgaaagggtacagaatgatggcctttatcctgccaccagttccaggaccaaag
ataaaaggcatagatacacatctgctggagacaggaaaatctgaagaattactgagtgct
cttggttgccatggtttccctccaacatcagactgtgaggaactactgatagaatatctg
gaggtagaggacagtgaggatcagcaacttatgccaagtcatgacactcccagtaaaaat
acaaaaattatgctcaaggaaacagacagtgactcaggccgagggagctgtgatagtcct
tctctcctccctgtgaagtgcagggaatcccgcagccttccatctgctcttcaaacacaa
gatgtaagagctaaagaaaagaaaggggggaaagggagctgggacactcggtgtatggcc
tcagaacagaaaacactcccttgtgagagtataaagacgtgcacttggctggcagctcag
ttacccagtaatcaggctgctatgtttgcctaccacagcactgtggaggcgttcaagata
acactgaacaccacaaatgtgaacaattcaccagttttggtgggaaatgaagaaaatcgt
cagtcgctatatcctattgctgaaactgtgtatgatgatgtggaaaaggtaagcgagatg
gagtattccaaaactgaccaaaccacagtgcaggtcagacaaaatgaacatagtaacaag
tcacctttcctgaatcctaaactaatggactatgtagaagttcataaagtcagacaagat
gaggaaccaactctattactgaaacataaagaaaacagtggaaagacaaaaaaatgcact
gttccaggaaccagcaaagaatataccaaggtctcaacagttgtggaccatcacatttta
gtattattgccagatcagcgcagccagaacacacctgtatctcaagaacctgtagcagaa
acatctcagaaccctcagcaaagtcaagctgagaagaacacaagctacagcacaacagct
ccaagtgactccagaagagacaccagtggatcagactacatggatccatcttcctttatg
ccgtccttcaaataa

DBGET integrated database retrieval system