KEGG   Taeniopygia guttata (zebra finch): 100219500Help
Entry
100219500         CDS       T01082                                 

Gene name
POR
Definition
P450 (cytochrome) oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     100219500 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 677 aa AA seqDB search
MGEPGMDPTMPAADSPAQQDSLFSMMDVFLISLITGLFTYWFFFRKKKEEVPDLPKMQSV
AAPVRDSSFIEKMKKTGRNIVVFYGSQTGTAEEFANRLSKDAHRYGLRGMTADPEEYDLS
DLSRLSEIDKSLAVFCMATYGEGDPTDNAQDFYDWLQEADADLSGLRFAVSGXGNKTYEH
FNAMGKYVDKRLEELGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEES
SIRQYELVVHTDVNMNKVYTGEMGRLKSYENQKPPFDAKNPFLAQVTENRKLNEGGERHL
MHLELDISNSKIRYESGDHVAVYPANDSSLVNQIGELLGTDLDTVMSLNNLDEESNKKHP
FPCPTSYRTALTYYLDITNPPRTNVLYELAQYASDTGEQERLRKMASSAAEGKALYLSWV
VEARRNILAILQDMPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSIHICAVTVEYET
KTGRLNKGVATSWLRSKVPEQNGSSSLVPMYVRKSQFRLPFKPSTPVIMIGPGTGIAPFI
GFIQERAWLKQQGKEVGETVLYYGCRREHEDYLYREELARFQKEGVLTQLNVAFSRDQAE
KVYVQHLLKKNKENVWKLINEGMAHIYVCGDARNMARDVQNTFYEIVSEFGNMSQPQAVD
YVKKLMTKGRYSLDVWS
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgggggagcccggcatggacccaaccatgccagctgctgacagccctgcacagcaggac
tctctcttcagcatgatggacgtgttcctcatctccctcatcactggactttttacctac
tggttcttcttccgcaagaaaaaggaggaagtgcctgacctccccaaaatgcagtcagta
gcagctccagtgagagacagcagcttcattgagaagatgaagaagacgggccgaaatata
gtggttttctatggttcccagacgggcacagcagaggagtttgccaatcgcctctccaaa
gatgcccatcgctatggcctccggggcatgacagcagatccagaggagtatgacctgtcg
gacctgagtcgcctctctgagattgacaagtccttggcagtgttctgcatggccacctat
ggagagggggatcccacagataatgcccaggatttctacgactggctgcaggaggctgat
gctgacctctcgggtctccggtttgcagtaagtggnnnggggaacaaaacttatgagcac
ttcaatgccatggggaagtacgtggacaagagactggaggagcttggagcccagcgcatc
tttgagctggggctgggagatgacgatggcaacctggaggaagatttcatcacctggaga
gagcagttctggccagcagtgtgtgagcactttggggtggaggctacaggagaagagtcc
agcatccggcagtacgagctggtggtgcacacagatgtgaacatgaacaaagtctacacg
ggggagatgggcagactcaagagctacgagaaccagaagcccccatttgatgccaagaac
cccttcctggctcaggttacagagaaccgcaagctgaacgagggcggagagcgacacttg
atgcacctggagctggatatctccaattccaaaatcaggtatgagtctggggaccacgtg
gccgtgtacccagccaacgactcctccctggtgaaccagattggtgagctcctgggcacg
gacctggacactgtcatgtccctaaacaacttggatgaggaatccaacaagaagcatccc
ttcccctgccccacatcgtaccggacagccctgacctactacctggacatcaccaaccct
ccccgcaccaacgtcctgtacgagctggcccagtacgcctcggacaccggcgagcaggag
cgcctccgcaaaatggcctcatctgctgccgagggcaaggcgctgtacctcagctgggtg
gtggaggcccgcaggaacatcctggccatcctgcaggacatgccctccctgcgccccccc
atcgaccacctgtgcgagctcctgccccgcctgcaggcccgctactactccatcgcctcc
tcctccaaggtccatcccaactccatccacatctgtgccgtgacggtggagtacgagacc
aagacgggccgcctgaacaaaggggtggccaccagctggctgaggagcaaggtgcctgag
cagaacgggagcagctccctggtgcccatgtacgtgcggaagtcgcagttccggctgccc
ttcaagcccagcacgcccgtgatcatgatcgggccgggcaccggcatcgcccccttcatc
ggcttcatccaggagcgcgcctggctgaagcagcagggcaaagaggtgggtgagacagtg
ctttactatggctgccgccgtgagcacgaggactacctgtaccgggaggagctggcccgc
ttccagaaggagggagtcctcacccagctcaacgtggccttttccagggaccaggctgag
aaggtttatgtccagcacttactgaagaagaacaaagaaaacgtctggaagctgattaat
gaggggatggctcacatctatgtgtgcggcgatgcccggaacatggcccgggacgtgcag
aacaccttctacgagatcgtgtccgagtttggcaacatgagccagccccaggctgtggac
tatgtaaagaaactgatgacaaagggccgctactccctggatgtgtggagctaa

DBGET integrated database retrieval system