KEGG   Taeniopygia guttata (zebra finch): 100219559Help
Entry
100219559         CDS       T01082                                 

Definition
(RefSeq) histone H2B 1/2/3/4/6
  KO
K11252  histone H2B
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Chromosome and associated proteins [BR:tgu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100219559
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100219559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 100219559
NCBI-ProteinID: XP_002194659
Ensembl: ENSTGUG00000009353
UniProt: H0ZG86
Position
1A
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagccggccaagtccgcccccgcgcccaagaagggctccaagaaggcggtgacc
aagacgcagaagaagggcgacaagaagcgcaagaagagccgtaaggaaagctactccatc
tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggtgaggcgtcgcgc
ctggcgcactacaacaagcgctccaccatcacctcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggctgtcacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system