KEGG   Taeniopygia guttata (zebra finch): 100219602Help
Entry
100219602         CDS       T01082                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
AGE-RAGE signaling pathway in diabetic complications
Influenza A
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100219602 (PIK3CB)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100219602 (PIK3CB)
   04370 VEGF signaling pathway
    100219602 (PIK3CB)
   04068 FoxO signaling pathway
    100219602 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    100219602 (PIK3CB)
   04150 mTOR signaling pathway
    100219602 (PIK3CB)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100219602 (PIK3CB)
  Cellular commiunity
   04510 Focal adhesion
    100219602 (PIK3CB)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100219602 (PIK3CB)
  Endocrine system
   04910 Insulin signaling pathway
    100219602 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    100219602 (PIK3CB)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100219602 (PIK3CB)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100219602 (PIK3CB)
  Infectious diseases
   05164 Influenza A
    100219602 (PIK3CB)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100219602 (PIK3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 921 aa AA seqDB search
MRRISEEKIQSLVGLSWMDWLKHTYPPEQETVIPESFQDKLYSGNLVVAVHFDNCQDVFS
FQVSPNMNPIKLNELAIRKRLTIHGKEDEEVDPADYVLQVSGRLEYVFGDHPLIQFQYIR
NCVMSRTLPQLTLVECCTIKKMCEQEMIAIEAAINRKSSNLPLPLPPKKTRATTSVWDIS
NPFKIILLKGNKLNTEENAKVHVRAGLFHGTELLCKTIVSTEISGRSDHVWNEVLEFEIN
VCDLPRMARLCFAVYAVMDKMKTKKSTKAMNPSKYQTIRKAGKVHYPVAWVNTMVFDYKG
HLRNGELVLHSWSSFPDELEEMLNPMGTVQTNPYTENATALHIRFQEYSKQPINYPPFDK
ILEKAAEIARNSDNAAMAGRGGKKFYVVLKDIMERDPLSQLCENEMDLIWTLRYDCRENF
PQSLPKLLLSLKWNKLEDVAQLQALLQIWPKLLPREALELLDFNYPDQYVREYAVGCLRQ
MSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALGNRRIGQMLFWHLRSEVHIPAVSV
QFGLILEAYCRGSVAHMKVLAKQVEALNKMKTLNSLIKLNAMKQSKAKGKDAMHTCLKQN
AYREALSDLQSPLNPSVILSELHVEKCRYMDSKMKPLWIVYNNKMFGGDLVGIIFKNGDD
LRQDMLTLQILRLMDILWKEAGLDLRILPYGCLATGDHSGLIEAVSSSETIADIQLNSSN
VAAAAAFNKDALLNWLKEYNLGDDLDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRK
NGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQGKTGNTEKFGRFRQYCEEA
YLILRKHGNLFITLFALMLTAGLPELTSIKDIQYLKDSLALGKSEEEALKQFKQKFDEAL
RESWTTKVNWMAHTVRKDYRS
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggatcagtgaggagaagattcagtcacttgtgggtctctcctggatggactgg
ttaaagcacacttaccctccagagcaggagactgttataccagagagcttccaagataag
ctctacagtggaaaccttgtagtagctgttcattttgacaactgccaggatgtatttagt
ttccaggtgtcccctaacatgaatcccatcaagctgaatgagctggcaatccgaaaacgt
ttgactatccatggaaaagaagatgaggaagttgatcctgctgattatgtgctgcaagtt
agtggaaggctggaatatgtctttggtgatcacccattaattcagttccagtacatccgc
aactgcgtgatgagcaggacccttccccagctgaccctggtggagtgctgcaccataaag
aagatgtgtgagcaggagatgattgccatagaagctgccataaaccgaaaatcctccaac
cttcctcttcctctgccaccaaaaaaaacaagagcaacaaccagtgtgtgggacatttct
aaccctttcaagattattctattaaagggcaataaactaaacacagaagaaaatgccaaa
gttcatgttagggctggtcttttccatggcacagagctcctttgtaaaacaattgtaagc
acagaaatatctgggagaagtgaccacgtttggaatgaagtgctggagtttgaaatcaat
gtctgtgatctgccaaggatggcaaggctctgctttgctgtttatgctgtcatggataag
atgaaaactaagaagtccaccaaggcaatgaatccttccaaataccaaaccattaggaaa
gcaggaaaagtgcattatcctgtagcctgggtaaataccatggtctttgattataaagga
cacttgaggaatggagaactggtgctgcacagctggtcatcatttcctgatgaacttgaa
gaaatgttgaatcccatgggaaccgtccagaccaacccttacactgaaaatgcaacagct
ttgcacattagatttcaggaatactcaaaacagcctattaattaccctccctttgataag
atacttgaaaaggcagctgagattgcaagaaacagtgacaatgctgcaatggcgggtcga
ggtggtaagaagttttatgttgtgctaaaagatataatggaaagagatcctttatctcag
ctttgtgaaaatgaaatggatctcatttggactttgcggtatgactgtcgtgaaaatttc
ccacaatcgttgccaaaactgctgctctctttaaagtggaacaaacttgaagatgttgct
cagcttcaggccctcctgcagatctggcccaagctgctgcccagggaggctttggagctt
ctggatttcaactaccctgaccagtatgtcagggaatatgcagtggggtgtttgaggcag
atgagtgatgaagagctctctcagtatcttctccaacttgtacaagtcctgaagtacgag
ccttttctggattgtgcactctccaggtttctcctggaaagagcacttggtaatcggaga
atcggacagatgttattctggcacctgaggtcggaggttcacatccccgccgtgtcggtg
cagttcggtctgatactggaggcttattgcagggggagcgtggctcacatgaaggtgctg
gctaaacaggtggaagccctcaataaaatgaagactttaaatagtctaattaagctgaat
gccatgaagcaaagcaaagcaaaaggcaaagatgcaatgcatacatgtttgaagcaaaat
gcttacagagaagcactttctgacctccagtctcctctgaatccttctgttatactctca
gagctgcatgttgagaagtgtagatatatggattctaaaatgaagcctctctggatagtg
tacaacaacaaaatgtttggaggagatcttgtagggatcatctttaaaaatggtgatgat
ctccggcaggacatgctgacgctgcagattttgcgcttgatggacattctgtggaaagag
gctggcctggatctccggatattgccctatggctgtttagcaactggagatcactctggc
ctcattgaggctgtttctagctcagaaactattgctgacattcagttaaacagcagcaat
gttgctgcagctgctgccttcaacaaggacgcactcttgaactggctgaaggaatacaat
ttaggagacgacttggatcgagccattgaagaatttaccctgtcttgtgctggctactgt
gtagctacatatgtgctgggaattggtgacagacacagtgacaatatcatggtcaggaaa
aatgggcagctctttcacatagattttgggcatattcttggaaactttaagtccaagttt
ggaattaaaagggaacgggtacctttcatactcacctatgatttcattcatgttattcaa
caaggaaaaacagggaacactgaaaaatttggtcggttccggcagtactgtgaggaagcc
tacctgatcctgcgcaagcacggcaacctatttattaccctctttgcactgatgctgact
gcagggctgccagagctcacctctatcaaggacatccagtatctcaaggactccctggcc
ttagggaagagtgaagaagaagcactaaaacagttcaagcaaaagtttgatgaagctctg
cgggaaagttggactactaaagtgaactggatggcccacactgtcagaaaagattacagg
tcctag

DBGET integrated database retrieval system