KEGG   Taeniopygia guttata (zebra finch): 100219602Help
Entry
100219602         CDS       T01082                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00562  Inositol phosphate metabolism
tgu04012  ErbB signaling pathway
tgu04068  FoxO signaling pathway
tgu04070  Phosphatidylinositol signaling system
tgu04140  Autophagy - animal
tgu04150  mTOR signaling pathway
tgu04210  Apoptosis
tgu04218  Cellular senescence
tgu04370  VEGF signaling pathway
tgu04510  Focal adhesion
tgu04620  Toll-like receptor signaling pathway
tgu04625  C-type lectin receptor signaling pathway
tgu04810  Regulation of actin cytoskeleton
tgu04910  Insulin signaling pathway
tgu04914  Progesterone-mediated oocyte maturation
tgu04933  AGE-RAGE signaling pathway in diabetic complications
tgu05164  Influenza A
Module
tgu_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100219602 (PIK3CB)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100219602 (PIK3CB)
   04370 VEGF signaling pathway
    100219602 (PIK3CB)
   04068 FoxO signaling pathway
    100219602 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    100219602 (PIK3CB)
   04150 mTOR signaling pathway
    100219602 (PIK3CB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100219602 (PIK3CB)
  Cell growth and death
   04210 Apoptosis
    100219602 (PIK3CB)
   04218 Cellular senescence
    100219602 (PIK3CB)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100219602 (PIK3CB)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100219602 (PIK3CB)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100219602 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    100219602 (PIK3CB)
  Endocrine system
   04910 Insulin signaling pathway
    100219602 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    100219602 (PIK3CB)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100219602 (PIK3CB)
  Infectious diseases
   05164 Influenza A
    100219602 (PIK3CB)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100219602 (PIK3CB)
Membrane trafficking [BR:tgu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100219602 (PIK3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135 DUF4381 RWD
Motif
Other DBs
NCBI-GeneID: 100219602
NCBI-ProteinID: XP_012430902
Ensembl: ENSTGUG00000005286
Position
9
AA seq 921 aa AA seqDB search
MRRISEEKIQSLVGLSWMDWLKHTYPPEQETVIPESFQDKLYSGNLVVAVHFDNCQDVFS
FQVSPNMNPIKLNELAIRKRLTIHGKEDEEVDPADYVLQVSGRLEYVFGDHPLIQFQYIR
NCVMSRTLPQLTLVECCTIKKMCEQEMIAIEAAINRKSSNLPLPLPPKKTRATTSVWDIS
NPFKIILLKGNKLNTEENAKVHVRAGLFHGTELLCKTIVSTEISGRSDHVWNEVLEFEIN
VCDLPRMARLCFAVYAVMDKMKTKKSTKAMNPSKYQTIRKAGKVHYPVAWVNTMVFDYKG
HLRNGELVLHSWSSFPDELEEMLNPMGTVQTNPYTENATALHIRFQEYSKQPINYPPFDK
ILEKAAEIARNSDNAAMAGRGGKKFYVVLKDIMERDPLSQLCENEMDLIWTLRYDCRENF
PQSLPKLLLSLKWNKLEDVAQLQALLQIWPKLLPREALELLDFNYPDQYVREYAVGCLRQ
MSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALGNRRIGQMLFWHLRSEVHIPAVSV
QFGLILEAYCRGSVAHMKVLAKQVEALNKMKTLNSLIKLNAMKQSKAKGKDAMHTCLKQN
AYREALSDLQSPLNPSVILSELHVEKCRYMDSKMKPLWIVYNNKMFGGDLVGIIFKNGDD
LRQDMLTLQILRLMDILWKEAGLDLRILPYGCLATGDHSGLIEAVSSSETIADIQLNSSN
VAAAAAFNKDALLNWLKEYNLGDDLDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRK
NGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQGKTGNTEKFGRFRQYCEEA
YLILRKHGNLFITLFALMLTAGLPELTSIKDIQYLKDSLALGKSEEEALKQFKQKFDEAL
RESWTTKVNWMAHTVRKDYRS
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggatcagtgaggagaagattcagtcacttgtgggtctctcctggatggactgg
ttaaagcacacttaccctccagagcaggagactgttataccagagagcttccaagataag
ctctacagtggaaaccttgtagtagctgttcattttgacaactgccaggatgtatttagt
ttccaggtgtcccctaacatgaatcccatcaagctgaatgagctggcaatccgaaaacgt
ttgactatccatggaaaagaagatgaggaagttgatcctgctgattatgtgctgcaagtt
agtggaaggctggaatatgtctttggtgatcacccattaattcagttccagtacatccgc
aactgcgtgatgagcaggacccttccccagctgaccctggtggagtgctgcaccataaag
aagatgtgtgagcaggagatgattgccatagaagctgccataaaccgaaaatcctccaac
cttcctcttcctctgccaccaaaaaaaacaagagcaacaaccagtgtgtgggacatttct
aaccctttcaagattattctattaaagggcaataaactaaacacagaagaaaatgccaaa
gttcatgttagggctggtcttttccatggcacagagctcctttgtaaaacaattgtaagc
acagaaatatctgggagaagtgaccacgtttggaatgaagtgctggagtttgaaatcaat
gtctgtgatctgccaaggatggcaaggctctgctttgctgtttatgctgtcatggataag
atgaaaactaagaagtccaccaaggcaatgaatccttccaaataccaaaccattaggaaa
gcaggaaaagtgcattatcctgtagcctgggtaaataccatggtctttgattataaagga
cacttgaggaatggagaactggtgctgcacagctggtcatcatttcctgatgaacttgaa
gaaatgttgaatcccatgggaaccgtccagaccaacccttacactgaaaatgcaacagct
ttgcacattagatttcaggaatactcaaaacagcctattaattaccctccctttgataag
atacttgaaaaggcagctgagattgcaagaaacagtgacaatgctgcaatggcgggtcga
ggtggtaagaagttttatgttgtgctaaaagatataatggaaagagatcctttatctcag
ctttgtgaaaatgaaatggatctcatttggactttgcggtatgactgtcgtgaaaatttc
ccacaatcgttgccaaaactgctgctctctttaaagtggaacaaacttgaagatgttgct
cagcttcaggccctcctgcagatctggcccaagctgctgcccagggaggctttggagctt
ctggatttcaactaccctgaccagtatgtcagggaatatgcagtggggtgtttgaggcag
atgagtgatgaagagctctctcagtatcttctccaacttgtacaagtcctgaagtacgag
ccttttctggattgtgcactctccaggtttctcctggaaagagcacttggtaatcggaga
atcggacagatgttattctggcacctgaggtcggaggttcacatccccgccgtgtcggtg
cagttcggtctgatactggaggcttattgcagggggagcgtggctcacatgaaggtgctg
gctaaacaggtggaagccctcaataaaatgaagactttaaatagtctaattaagctgaat
gccatgaagcaaagcaaagcaaaaggcaaagatgcaatgcatacatgtttgaagcaaaat
gcttacagagaagcactttctgacctccagtctcctctgaatccttctgttatactctca
gagctgcatgttgagaagtgtagatatatggattctaaaatgaagcctctctggatagtg
tacaacaacaaaatgtttggaggagatcttgtagggatcatctttaaaaatggtgatgat
ctccggcaggacatgctgacgctgcagattttgcgcttgatggacattctgtggaaagag
gctggcctggatctccggatattgccctatggctgtttagcaactggagatcactctggc
ctcattgaggctgtttctagctcagaaactattgctgacattcagttaaacagcagcaat
gttgctgcagctgctgccttcaacaaggacgcactcttgaactggctgaaggaatacaat
ttaggagacgacttggatcgagccattgaagaatttaccctgtcttgtgctggctactgt
gtagctacatatgtgctgggaattggtgacagacacagtgacaatatcatggtcaggaaa
aatgggcagctctttcacatagattttgggcatattcttggaaactttaagtccaagttt
ggaattaaaagggaacgggtacctttcatactcacctatgatttcattcatgttattcaa
caaggaaaaacagggaacactgaaaaatttggtcggttccggcagtactgtgaggaagcc
tacctgatcctgcgcaagcacggcaacctatttattaccctctttgcactgatgctgact
gcagggctgccagagctcacctctatcaaggacatccagtatctcaaggactccctggcc
ttagggaagagtgaagaagaagcactaaaacagttcaagcaaaagtttgatgaagctctg
cgggaaagttggactactaaagtgaactggatggcccacactgtcagaaaagattacagg
tcctag

DBGET integrated database retrieval system