KEGG   Taeniopygia guttata (zebra finch): 100219625Help
Entry
100219625         CDS       T01082                                 

Gene name
LAMC3
Definition
laminin, gamma 3
Orthology
K06247  
laminin, gamma 3
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:tgu04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:tgu04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
17
AA seq 1546 aa AA seqDB search
MAQPPWLCLLALLGLGLGGSSPCQDPRGQPRRCMPDFENAAFGRAVQVSNTCGSPPEDFC
LHTGGQHASALCHRCDATDPRRHHNASFLTDFHSQEESTWWQSQSMAFGIQYPNSVNITL
RLGKAYEITYVRLKFHTSRPESFAIYKRSRAEGPWVPFQFYSASCQKTYGKRPRQYLRPG
EDEQVAFCSDEFSDISPLSGGNVAFSTLEGRPSAYNFDGSPALQEWVTVTDLLISLNRLN
TFGDDIFKDPKVLQSYYYAISDFSVGGRCKCNGHASECAPDEAGQLVCVCQHHTAGTDCQ
RCQPFYQDRPWARGTAEAAHECLPCNCSGRSEECFYDRELFRRTGHGGHCLNCRDNTAGP
HCESCRQNYYRWEPQGTCQPCHCHPAGSLQPQCDNSGTCVCKANVTGWKCERCKDGYHSL
SEGGCRPCSCDPAGSVGTCDPTTGHCTCKERVEGHSCNRCQPGWFNLQPHNPIGCTSCFC
YGHSSACRAADGYEETCILSDFSQEKFLQNQRLSYGQLLSLLLGVENGTRTESGVPLLQV
QLLLEGEGMEITMSSSKSQLQHGKQAVTFRLHEAEEGAEPLLSAFSFQRLLSNLTSLRLR
VSSPGTHHPIPTPLSPLTGRLSLSEVQLTSARPGPGTRAGWVEECTCPMGYTGQFCQSCA
PGFKREIPFGGPFISCVPCTCNQHGDCHPLTGHCQCLHNTEGPFCERCSPGFYGNPFSGR
SDDCKPCPCPGRSPCTEVPSTGEVVCTHCPPGQRGKRCELCDDGFFGDPLGQRGPVHPCE
PCQCHGNVDLNAVGNCDPVSGRCLRCLYNTMGDHCERCRPGFYGDALAPSPAGKCAPCDC
NPSGSDPRMEGCDPGTGQCHCLPHVTGRACGQCQPGYYGLEPTVGCKSCECHPTGSRESG
CHVLTGQCSCQPGVTGKKCDQCQHGFFGFSARGCRACNCSPLGSITPQCHENSTCLCHPG
FVGYKCDRCQANFFLEPLSSRCQQCPACYGLVKDEAERLKARLQEMEEWLQNPGCDARPG
QSAMLGDAPRGDGLPSPHLLRGAWATLLVQVGQLAGALNTARGRLTNASRATRCSDHGPP
KTCTLLSEIGAVLQSAQQEILHAADTLATTEIPQEIPQQPTNWSHWALEAQALSKSHKES
MAQVEAVVRRALRASNASSELLQDLLEGNATGDVQHELEAGYEEIQRAQEELGAGMAEVA
VGARRAVTAVEQAHADLAERLLQVAALGQVLPVQAADLAQELAVLEQAAAAQEPLAQRAV
EASHTLAAGLQLELQRTQSFKQLQDQAGSAHDMATMAVSRGKAVLSDAESLLASLEGMKK
VLGHQKSQAALRRRMATVRDRVMVDAQRKIKQAEKTLGNSLSISITAQRTAGEAEQISEG
SAKRARAVLQESKHALKHASQLTTRANETQWELSRQEHMAEKLRADLEEAQQVGSEVSEM
AKSLQEARGSLMSDIETLNNLLNSLGNLEEHMEVDAVLSAGRLQLEQLWLRLATPGALAS
QLSRLQQEAAQQQEKIQAFESDLAEIRADKQNLEDILRSLPESCSK
NT seq 4641 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcctccctggctctgcctgctggccctgctggggctggggctggggggctca
tccccctgccaggaccctcggggacagccccgccgctgcatgcccgatttcgagaacgcc
gctttcggccgggccgtgcaggtcagcaacacctgcgggtcccccccggaggatttctgc
ctgcacacgggcggccagcacgccagcgccctgtgccaccgctgcgatgccaccgacccc
cggcgccaccacaacgcctccttcctcaccgacttccacagccaggaggagagcacctgg
tggcagagccagtccatggcctttggcatccagtaccccaactccgtcaacatcaccctg
cgcctgggcaaagcctacgagatcacctacgtgcggctgaagttccacaccagccgcccc
gagagcttcgccatctacaagcgcagccgcgccgaggggccctgggtgcccttccagttc
tacagcgcgtcctgccagaagacctacgggaagcggccgcggcagtacctgcggccaggc
gaggacgagcaggtggccttctgcagcgacgagttcagcgacatctccccgctcagcggg
ggcaacgtggccttctccaccctggagggacggcccagcgcctacaattttgatggaagc
cccgcgctgcaggagtgggtgacagtcactgacctgctcatctctttgaaccggctcaac
acatttggggatgacatcttcaaggaccccaaggtgttgcagtcatactactatgccata
tctgacttctccgttggtggcaggtgcaaatgcaatggccacgccagcgagtgcgcgccg
gacgaggccgggcagctggtgtgtgtgtgccagcaccacacggccggcaccgactgccag
cgctgccagcccttctaccaggaccggccctgggcgcgcggcacggccgaggctgcccac
gagtgcctcccttgcaactgcagcggccgctccgaggagtgcttctacgaccgggagctg
ttccggcgcaccgggcacgggggacactgcctcaactgccgcgacaacacggccgggccc
cactgcgagagctgcaggcagaactactaccgctgggagccgcagggaacctgccagccc
tgccactgccaccccgcaggttccctgcagccccagtgcgacaactcggggacctgcgtc
tgcaaagccaacgtgacgggctggaagtgcgagcgctgcaaggatggataccacagcctc
agcgaaggtggctgcagaccctgcagctgtgaccccgcgggcagcgtgggcacctgcgac
cccaccacggggcactgcacctgcaaggagagggtggaggggcactcgtgcaacaggtgc
cagccgggctggtttaacctacaaccccacaaccccatcggctgcaccagctgcttctgt
tacggccattccagcgcctgcagggcggcagatggctacgaggagacctgcatcctctcc
gacttcagccaagagaagtttctgcagaaccagcgcctcagttacgggcagctcctgtcc
ctgctgctgggagtggagaatgggacaagaacagaaagtggggtgcccctgctccaggtc
cagctgctgctggagggcgaggggatggagatcaccatgtccagcagcaagagccagctc
cagcatggaaagcaggctgtcaccttcaggctgcacgaggcagaggagggtgcggagcct
ttgctgtcggccttcagcttccagcgcctgctctccaacctgacctccctccgcctccgc
gtgagcagccccgggacgcaccatcccattcccacaccgctctcccctctcacaggcagg
ctgtccctgagcgaggtccagctcacatctgctcgccctgggccaggcacacgggcaggt
tgggtggaggagtgcacgtgtcccatgggctacaccgggcagttctgccagtcctgcgct
cctggattcaagagggagatcccatttggcggccccttcatcagctgcgtgccctgcacc
tgcaaccagcacggggactgccaccccctcacagggcactgccagtgcttgcacaacaca
gagggtcccttctgcgagcgctgcagccctggcttttatggcaaccccttctctgggcgc
tctgatgattgcaaaccctgcccctgccccggccgctcgccctgcaccgaggtgcccagc
actggggaggtggtctgcacccactgccccccggggcagagaggaaaacgctgtgagctc
tgtgatgacgggtttttcggggaccccctggggcagagaggacccgtgcatccctgtgag
ccctgccagtgccacgggaacgtggatctcaatgccgtgggcaactgtgaccccgtgtcg
ggccgatgcctgcgctgcctgtacaacacaatgggcgaccactgcgagaggtgtcggccg
ggcttctacggggatgcgctggctcccagccctgctggcaagtgtgcaccttgtgattgc
aaccccagtggctcagacccgaggatggagggctgtgatcctggcacgggccagtgccac
tgcctcccacacgtgacaggcagagcctgtgggcagtgccagcccggctactacggcctg
gagcccaccgtggggtgcaagagctgtgagtgccacccaacagggtcacgggagagcggg
tgccacgtgctgacggggcagtgctcctgccaacccggtgtcacagggaagaaatgtgat
cagtgccagcacggcttctttggcttctctgccaggggctgccgagcctgcaactgctcc
ccgctgggctccatcaccccgcagtgccacgagaacagcacctgcctgtgccaccctggc
ttcgtgggctacaagtgtgaccgctgccaggccaacttcttccttgagccactgagctcc
cgctgccagcagtgtcctgcctgctacgggctggtgaaggacgaggctgagcgcctcaag
gccaggctgcaggagatggaggagtggctgcagaacccaggctgtgatgcccgcccgggc
cagtctgccatgctgggagatgcaccccggggagatgggctgcccagcccacatctcctg
agaggtgcctgggccaccctcttggtacaggtggggcagctggcaggggcactgaacact
gcacggggccgtctcaccaatgccagccgggccaccagatgctctgaccatggacccccc
aagacctgcacgctgctctcggagattggggccgtgctgcagtcggcccagcaggagatc
ctgcatgctgcagacaccctggctaccacggaaattccccaggaaatcccacagcagccc
acaaactggagccactgggcactggaggctcaggctctgtccaagagccacaaggagtcc
atggcacaggtggaggccgtggtcaggagagcactgcgtgcctccaacgccagctccgag
ctcctgcaggacctgctggagggaaacgccacaggggacgtgcagcatgagctggaggct
gggtatgaggaaatccagcgggcgcaggaggagctgggtgctggcatggcagaggtggca
gtgggggccaggagagctgtgacagctgtggaacaggcacatgctgacctggctgagaga
cttttgcaggtggctgctctggggcaggtgctgccagtgcaggctgcagacctggcacag
gagctggcagtgctggagcaggcagcagcggcccaggagccgctggctcagcgggctgtg
gaggcatcccacacactggcagctggattgcagctggagctgcaaaggactcagagcttc
aagcagctgcaggaccaggctggctctgcccatgacatggccaccatggctgtctcccga
ggaaaagctgtgctctccgatgccgagtccctcctggccagcttggaaggcatgaagaag
gtgctggggcatcagaagagtcaggctgccctgaggaggaggatggccactgtgagggac
agagtgatggtggatgctcagaggaagattaaacaggcagagaagacactgggaaactcg
ctgtccatctccatcacagcccagaggacagctggggaggctgagcaaatctctgagggg
agtgccaagagggcacgggctgtgctgcaggagagcaaacacgccctcaaacacgccagc
cagctcaccacacgtgccaatgagacccagtgggagctctcccggcaggagcacatggct
gagaagctcagggcagacctggaggaagcacagcaggtgggatcagaggtgagtgaaatg
gcaaaaagtctgcaggaagcccggggctcactcatgtcagacatcgagaccctgaacaac
ctgctgaacagcttaggtaacctggaggagcacatggaggtggacgcagtgctgagcgcg
gggaggctgcagctggagcagctgtggctgcgcctggccacgccgggtgccctggccagc
cagctcagccggctgcagcaggaggcagcacagcagcaggagaagatccaagcatttgag
agcgacttggctgagatccgggctgacaagcagaacttggaggacattttgcggagcctc
cctgagagctgctccaagtga

DBGET integrated database retrieval system